WO2005052146A2 - Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same - Google Patents
Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same Download PDFInfo
- Publication number
- WO2005052146A2 WO2005052146A2 PCT/US2004/039066 US2004039066W WO2005052146A2 WO 2005052146 A2 WO2005052146 A2 WO 2005052146A2 US 2004039066 W US2004039066 W US 2004039066W WO 2005052146 A2 WO2005052146 A2 WO 2005052146A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protease
- amino acid
- seq
- acid sequence
- cellulomonas
- Prior art date
Links
- 102000004190 Enzymes Human genes 0.000 title claims abstract description 95
- 108090000790 Enzymes Proteins 0.000 title claims abstract description 95
- 239000013598 vector Substances 0.000 title claims abstract description 78
- 102000012479 Serine Proteases Human genes 0.000 title claims description 139
- 108010022999 Serine Proteases Proteins 0.000 title claims description 139
- 150000007523 nucleic acids Chemical class 0.000 title claims description 112
- 102000039446 nucleic acids Human genes 0.000 title description 79
- 108020004707 nucleic acids Proteins 0.000 title description 79
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 title description 4
- 108091005804 Peptidases Proteins 0.000 claims abstract description 462
- 102000035195 Peptidases Human genes 0.000 claims abstract description 458
- 239000004365 Protease Substances 0.000 claims abstract description 454
- 239000000203 mixture Substances 0.000 claims abstract description 188
- 241000186321 Cellulomonas Species 0.000 claims abstract description 157
- 238000004140 cleaning Methods 0.000 claims abstract description 125
- 230000002797 proteolythic effect Effects 0.000 claims abstract description 48
- 241001655327 Micrococcales Species 0.000 claims abstract description 44
- 241001465754 Metazoa Species 0.000 claims abstract description 14
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 187
- 238000000034 method Methods 0.000 claims description 98
- 229940088598 enzyme Drugs 0.000 claims description 93
- 102000040430 polynucleotide Human genes 0.000 claims description 78
- 108091033319 polynucleotide Proteins 0.000 claims description 78
- 239000002157 polynucleotide Substances 0.000 claims description 78
- 125000003729 nucleotide group Chemical group 0.000 claims description 63
- 238000006467 substitution reaction Methods 0.000 claims description 60
- 239000002773 nucleotide Substances 0.000 claims description 57
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 53
- 150000001413 amino acids Chemical class 0.000 claims description 53
- 230000000694 effects Effects 0.000 claims description 48
- 239000012634 fragment Substances 0.000 claims description 48
- 230000035772 mutation Effects 0.000 claims description 48
- 239000000523 sample Substances 0.000 claims description 47
- 239000013604 expression vector Substances 0.000 claims description 38
- 239000000463 material Substances 0.000 claims description 28
- 241000187747 Streptomyces Species 0.000 claims description 22
- 102220615939 Apolipoprotein E_R79T_mutation Human genes 0.000 claims description 18
- 241000193830 Bacillus <bacterium> Species 0.000 claims description 18
- 239000000758 substrate Substances 0.000 claims description 18
- 241000352063 Oerskovia Species 0.000 claims description 16
- 102220506594 Prolyl endopeptidase FAP_R123E_mutation Human genes 0.000 claims description 16
- 102220586763 Thioredoxin reductase 2, mitochondrial_R14L_mutation Human genes 0.000 claims description 16
- 238000005406 washing Methods 0.000 claims description 16
- 102220466383 PRA1 family protein 2_S76V_mutation Human genes 0.000 claims description 15
- 230000000295 complement effect Effects 0.000 claims description 15
- 238000006460 hydrolysis reaction Methods 0.000 claims description 15
- 230000007062 hydrolysis Effects 0.000 claims description 14
- 239000007788 liquid Substances 0.000 claims description 14
- 102200012477 rs111033675 Human genes 0.000 claims description 14
- 102220027019 rs63751595 Human genes 0.000 claims description 14
- 230000009260 cross reactivity Effects 0.000 claims description 13
- 102220044652 rs199966218 Human genes 0.000 claims description 13
- 102220286066 rs63750966 Human genes 0.000 claims description 13
- -1 sodium alkyl sulfate Chemical class 0.000 claims description 13
- 102220488976 Alkaline phosphatase, tissue-nonspecific isozyme_N170D_mutation Human genes 0.000 claims description 12
- 108010076119 Caseins Proteins 0.000 claims description 12
- 102000011632 Caseins Human genes 0.000 claims description 12
- 102220508341 E3 ubiquitin-protein ligase XIAP_Y75G_mutation Human genes 0.000 claims description 12
- 239000005018 casein Substances 0.000 claims description 12
- 235000021240 caseins Nutrition 0.000 claims description 12
- 102220034839 rs199475681 Human genes 0.000 claims description 12
- 102220011740 rs386833408 Human genes 0.000 claims description 12
- 102220327945 rs780020430 Human genes 0.000 claims description 12
- 239000004094 surface-active agent Substances 0.000 claims description 12
- 230000001131 transforming effect Effects 0.000 claims description 12
- 241000228212 Aspergillus Species 0.000 claims description 11
- 241000157932 Promicromonospora Species 0.000 claims description 11
- 241000329465 Xylanibacterium Species 0.000 claims description 11
- 230000001900 immune effect Effects 0.000 claims description 11
- 102220165167 rs772221026 Human genes 0.000 claims description 11
- 102220473072 Chemerin-like receptor 2_R14Q_mutation Human genes 0.000 claims description 10
- 102220517709 Heat shock protein 105 kDa_D184S_mutation Human genes 0.000 claims description 10
- 102220511220 Proteasome adapter and scaffold protein ECM29_R179K_mutation Human genes 0.000 claims description 10
- 102220599132 Receptor activity-modifying protein 1_R179E_mutation Human genes 0.000 claims description 10
- 241000223259 Trichoderma Species 0.000 claims description 10
- 102200077732 rs119463994 Human genes 0.000 claims description 10
- 102220624725 Atrial natriuretic peptide receptor 2_N24Q_mutation Human genes 0.000 claims description 9
- 102220547700 Carcinoembryonic antigen-related cell adhesion molecule 3_N74G_mutation Human genes 0.000 claims description 9
- 241000040869 Cellulosimicrobium Species 0.000 claims description 9
- 102220527020 Cytochrome b5 reductase 4_S99V_mutation Human genes 0.000 claims description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 claims description 9
- 102220625809 Phosphatidylethanolamine-binding protein 1_R14M_mutation Human genes 0.000 claims description 9
- 102220614767 Ras-related protein Rab-3B_T36N_mutation Human genes 0.000 claims description 9
- 241000187180 Streptomyces sp. Species 0.000 claims description 9
- 102220506801 Vitelline membrane outer layer protein 1 homolog_N73T_mutation Human genes 0.000 claims description 9
- 230000003197 catalytic effect Effects 0.000 claims description 9
- 239000004615 ingredient Substances 0.000 claims description 9
- 102200061168 rs150338273 Human genes 0.000 claims description 9
- 102220131850 rs199952414 Human genes 0.000 claims description 9
- 102220005319 rs33970699 Human genes 0.000 claims description 9
- 102220041793 rs375526246 Human genes 0.000 claims description 9
- 102220198954 rs759764705 Human genes 0.000 claims description 9
- 102220080468 rs797046020 Human genes 0.000 claims description 9
- 102220588928 60S ribosomal protein L30_A93V_mutation Human genes 0.000 claims description 8
- 241000194110 Bacillus sp. (in: Bacteria) Species 0.000 claims description 8
- 102220501440 Cytosolic iron-sulfur assembly component 3_N24H_mutation Human genes 0.000 claims description 8
- 102220622672 Ferroxidase HEPHL1_R14E_mutation Human genes 0.000 claims description 8
- 102220561347 KH homology domain-containing protein 1_N112E_mutation Human genes 0.000 claims description 8
- 102000011782 Keratins Human genes 0.000 claims description 8
- 108010076876 Keratins Proteins 0.000 claims description 8
- 102220595711 Lanosterol 14-alpha demethylase_G54W_mutation Human genes 0.000 claims description 8
- 102220642036 Lipoma-preferred partner_S76N_mutation Human genes 0.000 claims description 8
- 102220631334 NCK-interacting protein with SH3 domain_S92G_mutation Human genes 0.000 claims description 8
- 102220475960 Oligophrenin-1_R159A_mutation Human genes 0.000 claims description 8
- 102220491279 Peripheral myelin protein 22_S76I_mutation Human genes 0.000 claims description 8
- 102220516965 Podoplanin_R159N_mutation Human genes 0.000 claims description 8
- 102220591199 Receptor-type tyrosine-protein phosphatase kappa_R159E_mutation Human genes 0.000 claims description 8
- 102220547916 Serine protease HTRA2, mitochondrial_A93D_mutation Human genes 0.000 claims description 8
- 102220606006 Sorting nexin-10_R16L_mutation Human genes 0.000 claims description 8
- 102220484278 Thioredoxin domain-containing protein 8_R35A_mutation Human genes 0.000 claims description 8
- 102220522628 Urotensin-2 receptor_A70P_mutation Human genes 0.000 claims description 8
- 239000002253 acid Substances 0.000 claims description 8
- 102220352130 c.319A>T Human genes 0.000 claims description 8
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 claims description 8
- 239000004744 fabric Substances 0.000 claims description 8
- 102200103823 rs104886043 Human genes 0.000 claims description 8
- 102200006616 rs104894230 Human genes 0.000 claims description 8
- 102220261385 rs151112761 Human genes 0.000 claims description 8
- 102220256443 rs1553654496 Human genes 0.000 claims description 8
- 102220262976 rs1554306427 Human genes 0.000 claims description 8
- 102220264809 rs1554656491 Human genes 0.000 claims description 8
- 102220179273 rs199910582 Human genes 0.000 claims description 8
- 102200125028 rs2297411 Human genes 0.000 claims description 8
- 102220096863 rs375038808 Human genes 0.000 claims description 8
- 102220013614 rs397516692 Human genes 0.000 claims description 8
- 102220277845 rs532711949 Human genes 0.000 claims description 8
- 102220044422 rs587779921 Human genes 0.000 claims description 8
- 102220044570 rs587781404 Human genes 0.000 claims description 8
- 102200076359 rs59285727 Human genes 0.000 claims description 8
- 102200076362 rs59793293 Human genes 0.000 claims description 8
- 102220051104 rs727503347 Human genes 0.000 claims description 8
- 102220055035 rs727503797 Human genes 0.000 claims description 8
- 102220294566 rs747600463 Human genes 0.000 claims description 8
- 102220278506 rs760510019 Human genes 0.000 claims description 8
- 241000228257 Aspergillus sp. Species 0.000 claims description 7
- 102220473903 Desumoylating isopeptidase 1_S76D_mutation Human genes 0.000 claims description 7
- 102220560061 Phosphoserine phosphatase_T182V_mutation Human genes 0.000 claims description 7
- 102220473585 Putative ankyrin repeat domain-containing protein 26-like protein_S51A_mutation Human genes 0.000 claims description 7
- 241001557886 Trichoderma sp. Species 0.000 claims description 7
- 102200118278 rs33972593 Human genes 0.000 claims description 7
- 102220085077 rs63751465 Human genes 0.000 claims description 7
- 102220542336 60S ribosomal protein L27_H85T_mutation Human genes 0.000 claims description 6
- 108010065511 Amylases Proteins 0.000 claims description 6
- 102220622962 Cancer-related nucleoside-triphosphatase_N145E_mutation Human genes 0.000 claims description 6
- 102220499772 Carbonic anhydrase 2_N67L_mutation Human genes 0.000 claims description 6
- 102220499774 Carbonic anhydrase 2_N67Q_mutation Human genes 0.000 claims description 6
- 102220568823 Dual specificity mitogen-activated protein kinase kinase 1_G65V_mutation Human genes 0.000 claims description 6
- 102220499619 Dysferlin_R79D_mutation Human genes 0.000 claims description 6
- 102220580971 Induced myeloid leukemia cell differentiation protein Mcl-1_F47W_mutation Human genes 0.000 claims description 6
- 102220580942 Induced myeloid leukemia cell differentiation protein Mcl-1_Y57Y_mutation Human genes 0.000 claims description 6
- 102220624591 Kelch repeat and BTB domain-containing protein 3_T36Y_mutation Human genes 0.000 claims description 6
- 102220604794 Leukocyte immunoglobulin-like receptor subfamily A member 6_L69W_mutation Human genes 0.000 claims description 6
- 102220550213 Muscular LMNA-interacting protein_N145T_mutation Human genes 0.000 claims description 6
- 102220509369 Myeloid differentiation primary response protein MyD88_N67A_mutation Human genes 0.000 claims description 6
- 102220614752 Ras-related protein Rab-3B_T86E_mutation Human genes 0.000 claims description 6
- 102220473729 Ras-related protein Rab-5A_G54Q_mutation Human genes 0.000 claims description 6
- 102220568341 Segment polarity protein dishevelled homolog DVL-3_V66D_mutation Human genes 0.000 claims description 6
- 102220608115 TYRO protein tyrosine kinase-binding protein_G49L_mutation Human genes 0.000 claims description 6
- 102220499972 Target of EGR1 protein 1_R35E_mutation Human genes 0.000 claims description 6
- 102220346476 c.199A>T Human genes 0.000 claims description 6
- 102220222103 rs1060501223 Human genes 0.000 claims description 6
- 102220036452 rs137882485 Human genes 0.000 claims description 6
- 102220257439 rs1395190094 Human genes 0.000 claims description 6
- 102200108155 rs201717599 Human genes 0.000 claims description 6
- 102220005153 rs33922018 Human genes 0.000 claims description 6
- 102220163311 rs374919945 Human genes 0.000 claims description 6
- 102220093874 rs558707786 Human genes 0.000 claims description 6
- 102220048830 rs587783741 Human genes 0.000 claims description 6
- 102200087974 rs63751098 Human genes 0.000 claims description 6
- 102200026914 rs730882246 Human genes 0.000 claims description 6
- 102220095350 rs876659324 Human genes 0.000 claims description 6
- 102220192067 rs886057201 Human genes 0.000 claims description 6
- 102220264366 rs981346599 Human genes 0.000 claims description 6
- 102000013142 Amylases Human genes 0.000 claims description 5
- 102100032487 Beta-mannosidase Human genes 0.000 claims description 5
- 108090001060 Lipase Proteins 0.000 claims description 5
- 102000004882 Lipase Human genes 0.000 claims description 5
- 239000004367 Lipase Substances 0.000 claims description 5
- 102220537828 Nebulette_S15E_mutation Human genes 0.000 claims description 5
- 102220644612 Ribonuclease H2 subunit B_T163I_mutation Human genes 0.000 claims description 5
- 235000019418 amylase Nutrition 0.000 claims description 5
- 108010055059 beta-Mannosidase Proteins 0.000 claims description 5
- 102200120970 c.559T>C Human genes 0.000 claims description 5
- 239000003112 inhibitor Substances 0.000 claims description 5
- 235000019421 lipase Nutrition 0.000 claims description 5
- 102220233810 rs1085308047 Human genes 0.000 claims description 5
- 102200012163 rs111033699 Human genes 0.000 claims description 5
- 102200077973 rs113068438 Human genes 0.000 claims description 5
- 102200115358 rs121918322 Human genes 0.000 claims description 5
- 102220251157 rs1555197885 Human genes 0.000 claims description 5
- 102220624687 Atrial natriuretic peptide receptor 1_A70D_mutation Human genes 0.000 claims description 4
- 102220582890 Cellular tumor antigen p53_S15R_mutation Human genes 0.000 claims description 4
- 102220490416 DNA mismatch repair protein Mlh3_A41S_mutation Human genes 0.000 claims description 4
- 102220485974 Dihydropteridine reductase_S51T_mutation Human genes 0.000 claims description 4
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical group C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 claims description 4
- 102220551871 Fibroblast growth factor 13_R14T_mutation Human genes 0.000 claims description 4
- 102220597418 Fizzy-related protein homolog_T86M_mutation Human genes 0.000 claims description 4
- 102220581630 Haptoglobin-related protein_N42H_mutation Human genes 0.000 claims description 4
- 102220476940 Inactive ribonuclease-like protein 10_R127A_mutation Human genes 0.000 claims description 4
- 102220536072 Lysophospholipase_R61S_mutation Human genes 0.000 claims description 4
- 102220490323 Matrix metalloproteinase-27_N55Q_mutation Human genes 0.000 claims description 4
- 102220558400 Olfactory receptor 9G1_T62I_mutation Human genes 0.000 claims description 4
- 102220505637 Phospholipase A and acyltransferase 4_N112Q_mutation Human genes 0.000 claims description 4
- 102220502464 Polyadenylate-binding protein 2_R79E_mutation Human genes 0.000 claims description 4
- 102220553957 Protein Mpv17_V66E_mutation Human genes 0.000 claims description 4
- 102220502777 Putative C->U-editing enzyme APOBEC-4_G49K_mutation Human genes 0.000 claims description 4
- 102220573044 RNA polymerase II subunit A C-terminal domain phosphatase_T10Q_mutation Human genes 0.000 claims description 4
- 102220510525 Retinoic acid receptor alpha_R14D_mutation Human genes 0.000 claims description 4
- 102220528606 Ribonuclease P/MRP protein subunit POP5_S99D_mutation Human genes 0.000 claims description 4
- 102220587185 SPOC domain-containing protein 1_T46V_mutation Human genes 0.000 claims description 4
- 102220574655 Spindlin-1_D184R_mutation Human genes 0.000 claims description 4
- 102220358807 c.113C>T Human genes 0.000 claims description 4
- 102220407721 c.188G>T Human genes 0.000 claims description 4
- 102220411695 c.201C>A Human genes 0.000 claims description 4
- 102220370656 c.260C>A Human genes 0.000 claims description 4
- 102220360521 c.295T>A Human genes 0.000 claims description 4
- 102200080156 c.380G>A Human genes 0.000 claims description 4
- 102200127604 c.395C>T Human genes 0.000 claims description 4
- 102220427296 c.560G>C Human genes 0.000 claims description 4
- 102220370330 c.64G>T Human genes 0.000 claims description 4
- 239000003002 pH adjusting agent Substances 0.000 claims description 4
- 102220214681 rs1060502012 Human genes 0.000 claims description 4
- 102220216523 rs1060502977 Human genes 0.000 claims description 4
- 102220226389 rs1064794129 Human genes 0.000 claims description 4
- 102220232822 rs1085307660 Human genes 0.000 claims description 4
- 102200033400 rs1085307884 Human genes 0.000 claims description 4
- 102220044703 rs118029772 Human genes 0.000 claims description 4
- 102200031795 rs121913058 Human genes 0.000 claims description 4
- 102220124006 rs146704811 Human genes 0.000 claims description 4
- 102220273214 rs150038701 Human genes 0.000 claims description 4
- 102220317885 rs1554069716 Human genes 0.000 claims description 4
- 102220289644 rs1554885164 Human genes 0.000 claims description 4
- 102220283792 rs1555932896 Human genes 0.000 claims description 4
- 102220275909 rs1556267201 Human genes 0.000 claims description 4
- 102220264985 rs182760732 Human genes 0.000 claims description 4
- 102200125082 rs281875326 Human genes 0.000 claims description 4
- 102200045135 rs28937882 Human genes 0.000 claims description 4
- 102220005307 rs33922018 Human genes 0.000 claims description 4
- 102220232938 rs374550999 Human genes 0.000 claims description 4
- 102220223774 rs375605948 Human genes 0.000 claims description 4
- 102200038952 rs3762568 Human genes 0.000 claims description 4
- 102220214816 rs41294988 Human genes 0.000 claims description 4
- 102200058334 rs563581127 Human genes 0.000 claims description 4
- 102200076360 rs59285727 Human genes 0.000 claims description 4
- 102220181203 rs61744878 Human genes 0.000 claims description 4
- 102200044072 rs71647806 Human genes 0.000 claims description 4
- 102220057219 rs730881152 Human genes 0.000 claims description 4
- 102220218616 rs746322193 Human genes 0.000 claims description 4
- 102220277050 rs768444916 Human genes 0.000 claims description 4
- 102220082272 rs863223860 Human genes 0.000 claims description 4
- 102220226172 rs876661197 Human genes 0.000 claims description 4
- 102220137229 rs886056151 Human genes 0.000 claims description 4
- 102220151559 rs886060514 Human genes 0.000 claims description 4
- 102220243336 rs998365223 Human genes 0.000 claims description 4
- 239000011734 sodium Substances 0.000 claims description 4
- 229910052708 sodium Inorganic materials 0.000 claims description 4
- 239000003381 stabilizer Substances 0.000 claims description 4
- 102000004316 Oxidoreductases Human genes 0.000 claims description 3
- 108090000854 Oxidoreductases Proteins 0.000 claims description 3
- 102220363043 c.43A>G Human genes 0.000 claims description 3
- 230000002860 competitive effect Effects 0.000 claims description 3
- 238000009472 formulation Methods 0.000 claims description 3
- 102200006619 rs104894229 Human genes 0.000 claims description 3
- 102220024752 rs199473398 Human genes 0.000 claims description 3
- 102220125460 rs200793796 Human genes 0.000 claims description 3
- 102200015503 rs376306240 Human genes 0.000 claims description 3
- 102220257221 rs41294988 Human genes 0.000 claims description 3
- 102220504260 17-beta-hydroxysteroid dehydrogenase type 6_T39V_mutation Human genes 0.000 claims description 2
- 102220550021 3-ketoacyl-CoA thiolase, mitochondrial_T86D_mutation Human genes 0.000 claims description 2
- 102220574924 5'-AMP-activated protein kinase catalytic subunit alpha-2_T183E_mutation Human genes 0.000 claims description 2
- 102220474816 5,6-dihydroxyindole-2-carboxylic acid oxidase_V130T_mutation Human genes 0.000 claims description 2
- 102220542304 60S ribosomal protein L27_H85F_mutation Human genes 0.000 claims description 2
- 102220491114 ADP-ribosylation factor 6_T116Y_mutation Human genes 0.000 claims description 2
- 102220510638 APC membrane recruitment protein 1_G15Q_mutation Human genes 0.000 claims description 2
- 102220485317 ATP-dependent DNA/RNA helicase DHX36_G63P_mutation Human genes 0.000 claims description 2
- 102220588823 Acidic mammalian chitinase_R61M_mutation Human genes 0.000 claims description 2
- 102220495810 Alkaline ceramidase 3_N24G_mutation Human genes 0.000 claims description 2
- 102220528278 Alpha-L-iduronidase_S113D_mutation Human genes 0.000 claims description 2
- 102220644433 Arylamine N-acetyltransferase 1_D2T_mutation Human genes 0.000 claims description 2
- 102220617295 CPX chromosomal region candidate gene 1 protein_A83F_mutation Human genes 0.000 claims description 2
- 102220617294 CPX chromosomal region candidate gene 1 protein_A83I_mutation Human genes 0.000 claims description 2
- 102220645952 Cell surface A33 antigen_T109K_mutation Human genes 0.000 claims description 2
- 108010084185 Cellulases Proteins 0.000 claims description 2
- 102000005575 Cellulases Human genes 0.000 claims description 2
- 102220616214 Clusterin_N145Q_mutation Human genes 0.000 claims description 2
- 102220519282 Conserved oligomeric Golgi complex subunit 3_P89D_mutation Human genes 0.000 claims description 2
- 102220540933 Disabled homolog 2_F166A_mutation Human genes 0.000 claims description 2
- 102220472493 EF-hand calcium-binding domain-containing protein 7_F27I_mutation Human genes 0.000 claims description 2
- 102220482162 Endothelial differentiation-related factor 1_T40D_mutation Human genes 0.000 claims description 2
- 102220559991 Epsilon-sarcoglycan_T36R_mutation Human genes 0.000 claims description 2
- 102220523126 Eukaryotic translation initiation factor 4E-binding protein 2_T46E_mutation Human genes 0.000 claims description 2
- 102220497493 Fatty acid-binding protein, liver_N55V_mutation Human genes 0.000 claims description 2
- 102220590602 Gap junction beta-1 protein_T86N_mutation Human genes 0.000 claims description 2
- 102220629278 Glutathione S-transferase kappa 1_T121L_mutation Human genes 0.000 claims description 2
- 102220571078 Growth arrest and DNA damage-inducible protein GADD45 gamma_A83R_mutation Human genes 0.000 claims description 2
- 102220508853 Guanine deaminase_R179A_mutation Human genes 0.000 claims description 2
- 102220556338 H/ACA ribonucleoprotein complex non-core subunit NAF1_P43L_mutation Human genes 0.000 claims description 2
- 102220514941 HMG domain-containing protein 3_S18E_mutation Human genes 0.000 claims description 2
- 102220491780 High mobility group protein B1_R123A_mutation Human genes 0.000 claims description 2
- 102220633409 Homeobox protein OTX2_P134A_mutation Human genes 0.000 claims description 2
- 102220517934 Hyaluronidase-2_D2Q_mutation Human genes 0.000 claims description 2
- 102220580968 Induced myeloid leukemia cell differentiation protein Mcl-1_F47Y_mutation Human genes 0.000 claims description 2
- 102220498733 Interleukin-6 receptor subunit alpha_N55A_mutation Human genes 0.000 claims description 2
- 102220555777 MORC family CW-type zinc finger protein 1_R14K_mutation Human genes 0.000 claims description 2
- 102220538147 Methionine-tRNA ligase, cytoplasmic_A64R_mutation Human genes 0.000 claims description 2
- 102220612414 Mitogen-activated protein kinase kinase kinase 1_T160D_mutation Human genes 0.000 claims description 2
- 102220559160 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial_S15T_mutation Human genes 0.000 claims description 2
- 102220525899 NADH-ubiquinone oxidoreductase chain 4_T109P_mutation Human genes 0.000 claims description 2
- 102220591745 NF-kappa-B inhibitor-interacting Ras-like protein 1_N24F_mutation Human genes 0.000 claims description 2
- 101100404023 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) arg-14 gene Proteins 0.000 claims description 2
- 101100498071 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) cys-17 gene Proteins 0.000 claims description 2
- 102100027341 Neutral and basic amino acid transport protein rBAT Human genes 0.000 claims description 2
- 102220482843 Nucleoredoxin-like protein 2_S76C_mutation Human genes 0.000 claims description 2
- 102220475607 Oligophrenin-1_G49V_mutation Human genes 0.000 claims description 2
- 101150042254 P43K gene Proteins 0.000 claims description 2
- 102220531936 Phenylethanolamine N-methyltransferase_S188C_mutation Human genes 0.000 claims description 2
- 102220481291 Podocan_V66A_mutation Human genes 0.000 claims description 2
- 108010059820 Polygalacturonase Proteins 0.000 claims description 2
- 102220629446 Presenilin-1_T116N_mutation Human genes 0.000 claims description 2
- 102220512973 Probable JmjC domain-containing histone demethylation protein 2C_G91Q_mutation Human genes 0.000 claims description 2
- 102220535519 Probable methyltransferase TARBP1_T86F_mutation Human genes 0.000 claims description 2
- 102220606029 Protein C19orf12_A48P_mutation Human genes 0.000 claims description 2
- 102220537319 Protein NDRG2_G26K_mutation Human genes 0.000 claims description 2
- 102220473717 Putative ankyrin repeat domain-containing protein 26-like protein_S113A_mutation Human genes 0.000 claims description 2
- 102220477122 Putative uncharacterized protein PP632_R96E_mutation Human genes 0.000 claims description 2
- 102220644605 Ribonuclease H2 subunit B_P43H_mutation Human genes 0.000 claims description 2
- 102220493820 STAM-binding protein_R14P_mutation Human genes 0.000 claims description 2
- 102220509307 Small integral membrane protein 10_H32A_mutation Human genes 0.000 claims description 2
- 102220563212 Stonin-1_T182W_mutation Human genes 0.000 claims description 2
- 102220498108 Transmembrane 4 L6 family member 20_G12P_mutation Human genes 0.000 claims description 2
- 102220522584 Ubiquitin-fold modifier 1_A48Q_mutation Human genes 0.000 claims description 2
- 102220522768 Ubiquitin-fold modifier 1_R79A_mutation Human genes 0.000 claims description 2
- 102220475455 Vexin_T46W_mutation Human genes 0.000 claims description 2
- 102220482578 Zinc finger MYM-type protein 5_S114G_mutation Human genes 0.000 claims description 2
- 229940025131 amylases Drugs 0.000 claims description 2
- 239000003945 anionic surfactant Substances 0.000 claims description 2
- 229910021538 borax Inorganic materials 0.000 claims description 2
- 102220415904 c.104G>A Human genes 0.000 claims description 2
- 102220344987 c.118A>C Human genes 0.000 claims description 2
- 102220417897 c.12G>A Human genes 0.000 claims description 2
- 102220417895 c.134G>T Human genes 0.000 claims description 2
- 102220419550 c.160G>A Human genes 0.000 claims description 2
- 102220424051 c.22G>C Human genes 0.000 claims description 2
- 102220352322 c.232A>C Human genes 0.000 claims description 2
- 102220346307 c.253C>T Human genes 0.000 claims description 2
- 102220349282 c.275C>G Human genes 0.000 claims description 2
- 102200026578 c.320C>T Human genes 0.000 claims description 2
- 102220361157 c.385A>T Human genes 0.000 claims description 2
- 102220412019 c.38G>A Human genes 0.000 claims description 2
- 102220361177 c.41A>T Human genes 0.000 claims description 2
- 102220350789 c.44C>A Human genes 0.000 claims description 2
- 102200001064 c.560C>T Human genes 0.000 claims description 2
- 102220349549 c.73G>A Human genes 0.000 claims description 2
- 102220362576 c.78G>T Human genes 0.000 claims description 2
- 108010005400 cutinase Proteins 0.000 claims description 2
- 108010093305 exopolygalacturonase Proteins 0.000 claims description 2
- 108010002430 hemicellulase Proteins 0.000 claims description 2
- 239000001257 hydrogen Substances 0.000 claims description 2
- 229910052739 hydrogen Inorganic materials 0.000 claims description 2
- 102220006123 rs1042713 Human genes 0.000 claims description 2
- 102200036620 rs104893878 Human genes 0.000 claims description 2
- 102200006659 rs104894226 Human genes 0.000 claims description 2
- 102220198095 rs104894228 Human genes 0.000 claims description 2
- 102200006655 rs104894230 Human genes 0.000 claims description 2
- 102200086214 rs104894627 Human genes 0.000 claims description 2
- 102220197507 rs1057519494 Human genes 0.000 claims description 2
- 102220207737 rs1057520334 Human genes 0.000 claims description 2
- 102220214679 rs1060502034 Human genes 0.000 claims description 2
- 102220234445 rs1064796078 Human genes 0.000 claims description 2
- 102220234201 rs1114167802 Human genes 0.000 claims description 2
- 102220042509 rs112033303 Human genes 0.000 claims description 2
- 102220234763 rs1131690823 Human genes 0.000 claims description 2
- 102220235983 rs1131691324 Human genes 0.000 claims description 2
- 102220236858 rs1135401834 Human genes 0.000 claims description 2
- 102220164886 rs113754532 Human genes 0.000 claims description 2
- 102200050865 rs11568437 Human genes 0.000 claims description 2
- 102220006755 rs118192193 Human genes 0.000 claims description 2
- 102220323536 rs1198070818 Human genes 0.000 claims description 2
- 102200054108 rs121907979 Human genes 0.000 claims description 2
- 102200024822 rs121908823 Human genes 0.000 claims description 2
- 102200162389 rs121909144 Human genes 0.000 claims description 2
- 102220287600 rs1331134740 Human genes 0.000 claims description 2
- 102220268695 rs1347755761 Human genes 0.000 claims description 2
- 102200063015 rs137852850 Human genes 0.000 claims description 2
- 102220000174 rs137854545 Human genes 0.000 claims description 2
- 102220217823 rs138107415 Human genes 0.000 claims description 2
- 102220094507 rs143145868 Human genes 0.000 claims description 2
- 102220285261 rs1443234544 Human genes 0.000 claims description 2
- 102200079503 rs144830740 Human genes 0.000 claims description 2
- 102200133062 rs144917638 Human genes 0.000 claims description 2
- 102220259596 rs146705057 Human genes 0.000 claims description 2
- 102220219903 rs149277592 Human genes 0.000 claims description 2
- 102220316220 rs1553408451 Human genes 0.000 claims description 2
- 102220295568 rs1554341697 Human genes 0.000 claims description 2
- 102220279306 rs1555054109 Human genes 0.000 claims description 2
- 102220248505 rs1555565283 Human genes 0.000 claims description 2
- 102220284500 rs1557107543 Human genes 0.000 claims description 2
- 102200068630 rs1805142 Human genes 0.000 claims description 2
- 102220054557 rs188030007 Human genes 0.000 claims description 2
- 102220024746 rs199473444 Human genes 0.000 claims description 2
- 102220309481 rs199473665 Human genes 0.000 claims description 2
- 102220130643 rs200501999 Human genes 0.000 claims description 2
- 102200023403 rs244903 Human genes 0.000 claims description 2
- 102200082949 rs33916412 Human genes 0.000 claims description 2
- 102220005190 rs33930385 Human genes 0.000 claims description 2
- 102200082877 rs33935445 Human genes 0.000 claims description 2
- 102200158798 rs35687396 Human genes 0.000 claims description 2
- 102220005293 rs35960772 Human genes 0.000 claims description 2
- 102200082869 rs36006214 Human genes 0.000 claims description 2
- 102220239479 rs368549770 Human genes 0.000 claims description 2
- 102200049696 rs374550999 Human genes 0.000 claims description 2
- 102220197700 rs376207800 Human genes 0.000 claims description 2
- 102220007672 rs397514468 Human genes 0.000 claims description 2
- 102220012367 rs397516025 Human genes 0.000 claims description 2
- 102220013075 rs397516450 Human genes 0.000 claims description 2
- 102220030804 rs398124244 Human genes 0.000 claims description 2
- 102200088008 rs41294988 Human genes 0.000 claims description 2
- 102220034241 rs483352780 Human genes 0.000 claims description 2
- 102200152570 rs483352923 Human genes 0.000 claims description 2
- 102220046484 rs527236096 Human genes 0.000 claims description 2
- 102220273713 rs542684395 Human genes 0.000 claims description 2
- 102220229932 rs56026142 Human genes 0.000 claims description 2
- 102220036630 rs587779921 Human genes 0.000 claims description 2
- 102200062512 rs587782343 Human genes 0.000 claims description 2
- 102220047564 rs587783065 Human genes 0.000 claims description 2
- 102200076355 rs59793293 Human genes 0.000 claims description 2
- 102200072129 rs61748438 Human genes 0.000 claims description 2
- 102220004066 rs62637021 Human genes 0.000 claims description 2
- 102200004882 rs62638643 Human genes 0.000 claims description 2
- 102220243618 rs63750010 Human genes 0.000 claims description 2
- 102220027379 rs63750894 Human genes 0.000 claims description 2
- 102200082875 rs63751285 Human genes 0.000 claims description 2
- 102220053527 rs727504249 Human genes 0.000 claims description 2
- 102220053532 rs727504496 Human genes 0.000 claims description 2
- 102200008507 rs74315411 Human genes 0.000 claims description 2
- 102220151971 rs747723725 Human genes 0.000 claims description 2
- 102220319835 rs761360080 Human genes 0.000 claims description 2
- 102220266191 rs761462996 Human genes 0.000 claims description 2
- 102220076309 rs765897138 Human genes 0.000 claims description 2
- 102200153441 rs768834663 Human genes 0.000 claims description 2
- 102220241926 rs782376691 Human genes 0.000 claims description 2
- 102220077270 rs797044995 Human genes 0.000 claims description 2
- 102220087251 rs864622477 Human genes 0.000 claims description 2
- 102220094050 rs876660332 Human genes 0.000 claims description 2
- 102220093586 rs876661278 Human genes 0.000 claims description 2
- 102220171371 rs886048442 Human genes 0.000 claims description 2
- 102220181810 rs886053250 Human genes 0.000 claims description 2
- 102220134669 rs886054796 Human genes 0.000 claims description 2
- 102220314565 rs912456299 Human genes 0.000 claims description 2
- 239000004328 sodium tetraborate Substances 0.000 claims description 2
- 235000010339 sodium tetraborate Nutrition 0.000 claims description 2
- 102220370301 c.47G>A Human genes 0.000 claims 13
- 102220591670 WW domain-binding protein 2_Y75F_mutation Human genes 0.000 claims 4
- 102220235788 rs1131691637 Human genes 0.000 claims 4
- 102220557856 Prostate stem cell antigen_R16E_mutation Human genes 0.000 claims 2
- 102220488764 ADP-ribosylation factor 1_Q71L_mutation Human genes 0.000 claims 1
- 102220640730 ALK tyrosine kinase receptor_G84P_mutation Human genes 0.000 claims 1
- 102220486164 Alkaline ceramidase 1_Q81D_mutation Human genes 0.000 claims 1
- 102220508358 E3 ubiquitin-protein ligase XIAP_V80A_mutation Human genes 0.000 claims 1
- 102220593922 HORMA domain-containing protein 1_R16K_mutation Human genes 0.000 claims 1
- 102220502546 Mitogen-activated protein kinase-binding protein 1_S140A_mutation Human genes 0.000 claims 1
- 102220032414 rs104895288 Human genes 0.000 claims 1
- 102220193254 rs1057516138 Human genes 0.000 claims 1
- 102220127662 rs202142404 Human genes 0.000 claims 1
- 102220294048 rs369447363 Human genes 0.000 claims 1
- 102200124144 rs5030878 Human genes 0.000 claims 1
- 102200004721 rs59970018 Human genes 0.000 claims 1
- 102220058399 rs730881696 Human genes 0.000 claims 1
- 102220258499 rs752850761 Human genes 0.000 claims 1
- 102220225547 rs754043874 Human genes 0.000 claims 1
- 102220060547 rs786203080 Human genes 0.000 claims 1
- 102220018750 rs80358450 Human genes 0.000 claims 1
- 102200083605 rs863225122 Human genes 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 abstract description 192
- 102000004169 proteins and genes Human genes 0.000 abstract description 88
- 239000003599 detergent Substances 0.000 abstract description 38
- 238000012545 processing Methods 0.000 abstract description 12
- 239000004753 textile Substances 0.000 abstract description 9
- 239000010985 leather Substances 0.000 abstract description 6
- 101000964562 Homo sapiens Zinc finger FYVE domain-containing protein 9 Proteins 0.000 abstract description 4
- 102100040801 Zinc finger FYVE domain-containing protein 9 Human genes 0.000 abstract description 4
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 abstract 4
- 235000019419 proteases Nutrition 0.000 description 235
- 210000004027 cell Anatomy 0.000 description 134
- 108090000765 processed proteins & peptides Proteins 0.000 description 96
- 108020004414 DNA Proteins 0.000 description 93
- 102000053602 DNA Human genes 0.000 description 91
- 102000004196 processed proteins & peptides Human genes 0.000 description 84
- 235000018102 proteins Nutrition 0.000 description 81
- 229920001184 polypeptide Polymers 0.000 description 78
- 235000001014 amino acid Nutrition 0.000 description 56
- 239000013615 primer Substances 0.000 description 49
- 229940024606 amino acid Drugs 0.000 description 47
- 108010076504 Protein Sorting Signals Proteins 0.000 description 37
- 230000014509 gene expression Effects 0.000 description 28
- 239000013612 plasmid Substances 0.000 description 27
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 26
- 230000001580 bacterial effect Effects 0.000 description 25
- 239000002243 precursor Substances 0.000 description 24
- 238000003199 nucleic acid amplification method Methods 0.000 description 23
- 241000894006 Bacteria Species 0.000 description 22
- 230000003321 amplification Effects 0.000 description 22
- 238000003752 polymerase chain reaction Methods 0.000 description 21
- 241000894007 species Species 0.000 description 21
- 239000003550 marker Substances 0.000 description 20
- 239000002609 medium Substances 0.000 description 20
- 239000000047 product Substances 0.000 description 19
- 108091034117 Oligonucleotide Proteins 0.000 description 17
- 238000009396 hybridization Methods 0.000 description 16
- 238000004422 calculation algorithm Methods 0.000 description 15
- 230000006870 function Effects 0.000 description 15
- 230000008569 process Effects 0.000 description 14
- 238000012216 screening Methods 0.000 description 14
- 230000012010 growth Effects 0.000 description 13
- 102220064451 rs368865412 Human genes 0.000 description 13
- 238000003556 assay Methods 0.000 description 12
- 238000002703 mutagenesis Methods 0.000 description 11
- 231100000350 mutagenesis Toxicity 0.000 description 11
- 241000186218 Oerskovia turbata Species 0.000 description 10
- 108090000787 Subtilisin Proteins 0.000 description 10
- 239000002585 base Substances 0.000 description 10
- 239000003795 chemical substances by application Substances 0.000 description 10
- 210000000349 chromosome Anatomy 0.000 description 10
- 231100000219 mutagenic Toxicity 0.000 description 10
- 230000003505 mutagenic effect Effects 0.000 description 10
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 10
- 229910001868 water Inorganic materials 0.000 description 10
- 241001655317 Cellulomonadaceae Species 0.000 description 9
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 230000000052 comparative effect Effects 0.000 description 9
- 239000002299 complementary DNA Substances 0.000 description 9
- 230000002538 fungal effect Effects 0.000 description 9
- 238000003780 insertion Methods 0.000 description 9
- 230000037431 insertion Effects 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 241001289504 Cellulomonas humilata Species 0.000 description 8
- 108020004511 Recombinant DNA Proteins 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 239000002738 chelating agent Substances 0.000 description 8
- 238000010367 cloning Methods 0.000 description 8
- 238000001514 detection method Methods 0.000 description 8
- 230000002068 genetic effect Effects 0.000 description 8
- 230000002352 nonmutagenic effect Effects 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 230000028327 secretion Effects 0.000 description 8
- 238000003786 synthesis reaction Methods 0.000 description 8
- 238000013518 transcription Methods 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 108020004465 16S ribosomal RNA Proteins 0.000 description 7
- 241000157920 Cellulomonas cellasea Species 0.000 description 7
- 108020004705 Codon Proteins 0.000 description 7
- 238000002835 absorbance Methods 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 230000002759 chromosomal effect Effects 0.000 description 7
- 238000000855 fermentation Methods 0.000 description 7
- 230000004151 fermentation Effects 0.000 description 7
- 230000028993 immune response Effects 0.000 description 7
- 239000011159 matrix material Substances 0.000 description 7
- 230000010076 replication Effects 0.000 description 7
- 150000003839 salts Chemical class 0.000 description 7
- 238000010561 standard procedure Methods 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- 241000186320 Cellulomonas fimi Species 0.000 description 6
- 241000186220 Cellulomonas flavigena Species 0.000 description 6
- 108091035707 Consensus sequence Proteins 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- 241000187398 Streptomyces lividans Species 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 230000003301 hydrolyzing effect Effects 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 239000000843 powder Substances 0.000 description 6
- 230000003248 secreting effect Effects 0.000 description 6
- 230000002103 transcriptional effect Effects 0.000 description 6
- 235000014469 Bacillus subtilis Nutrition 0.000 description 5
- 241000186318 Cellulomonas biazotea Species 0.000 description 5
- 241000186219 Cellulomonas gelida Species 0.000 description 5
- 241000024412 Cellulomonas hominis Species 0.000 description 5
- 241001291897 Cellulomonas iranensis Species 0.000 description 5
- 241001291898 Cellulomonas persica Species 0.000 description 5
- 241000186217 Cellulomonas uda Species 0.000 description 5
- 241000192125 Firmicutes Species 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 230000036425 denaturation Effects 0.000 description 5
- 238000004925 denaturation Methods 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000002255 enzymatic effect Effects 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 230000014616 translation Effects 0.000 description 5
- 241001156739 Actinobacteria <phylum> Species 0.000 description 4
- 241000203809 Actinomycetales Species 0.000 description 4
- 241000228245 Aspergillus niger Species 0.000 description 4
- 241001328122 Bacillus clausii Species 0.000 description 4
- 102220628832 Beta-secretase 1_Y75F_mutation Human genes 0.000 description 4
- 244000025254 Cannabis sativa Species 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 239000003155 DNA primer Substances 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 241000233866 Fungi Species 0.000 description 4
- 241000193385 Geobacillus stearothermophilus Species 0.000 description 4
- 241000157927 Oerskovia enterophila Species 0.000 description 4
- 241001655316 Promicromonosporaceae Species 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 4
- 238000000137 annealing Methods 0.000 description 4
- 230000000845 anti-microbial effect Effects 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000004851 dishwashing Methods 0.000 description 4
- 239000003623 enhancer Substances 0.000 description 4
- 239000000945 filler Substances 0.000 description 4
- 238000002744 homologous recombination Methods 0.000 description 4
- 230000006801 homologous recombination Effects 0.000 description 4
- 230000002779 inactivation Effects 0.000 description 4
- 235000013336 milk Nutrition 0.000 description 4
- 239000008267 milk Substances 0.000 description 4
- 210000004080 milk Anatomy 0.000 description 4
- 230000001590 oxidative effect Effects 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 239000002987 primer (paints) Substances 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 102220076772 rs780110473 Human genes 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 241000157921 Actinotalea fermentans Species 0.000 description 3
- 239000004382 Amylase Substances 0.000 description 3
- 208000035404 Autolysis Diseases 0.000 description 3
- 241000193744 Bacillus amyloliquefaciens Species 0.000 description 3
- 241000193422 Bacillus lentus Species 0.000 description 3
- 241000194108 Bacillus licheniformis Species 0.000 description 3
- 108091005658 Basic proteases Proteins 0.000 description 3
- 206010057248 Cell death Diseases 0.000 description 3
- 108010059892 Cellulase Proteins 0.000 description 3
- 241000631018 Cellulomonas xylanilytica Species 0.000 description 3
- 241000186221 Cellulosimicrobium cellulans Species 0.000 description 3
- 108090000317 Chymotrypsin Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- 241000342355 Oerskovia jenensis Species 0.000 description 3
- 241000342360 Oerskovia paurometabola Species 0.000 description 3
- 101710105014 Putative serine protease Proteins 0.000 description 3
- 108010056079 Subtilisins Proteins 0.000 description 3
- 102000005158 Subtilisins Human genes 0.000 description 3
- 241000499912 Trichoderma reesei Species 0.000 description 3
- 108090000631 Trypsin Proteins 0.000 description 3
- 102000004142 Trypsin Human genes 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 239000004599 antimicrobial Substances 0.000 description 3
- 239000007844 bleaching agent Substances 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 229940106157 cellulase Drugs 0.000 description 3
- 229960002376 chymotrypsin Drugs 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 230000001186 cumulative effect Effects 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 210000004209 hair Anatomy 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000011256 inorganic filler Substances 0.000 description 3
- 229910003475 inorganic filler Inorganic materials 0.000 description 3
- 230000010354 integration Effects 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 3
- 108010020132 microbial serine proteinases Proteins 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 230000003647 oxidation Effects 0.000 description 3
- 238000007254 oxidation reaction Methods 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 230000008521 reorganization Effects 0.000 description 3
- 230000028043 self proteolysis Effects 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000007858 starting material Substances 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 239000012588 trypsin Substances 0.000 description 3
- AZQWKYJCGOJGHM-UHFFFAOYSA-N 1,4-benzoquinone Chemical compound O=C1C=CC(=O)C=C1 AZQWKYJCGOJGHM-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 108090000915 Aminopeptidases Proteins 0.000 description 2
- 102000004400 Aminopeptidases Human genes 0.000 description 2
- 244000063299 Bacillus subtilis Species 0.000 description 2
- 241000193388 Bacillus thuringiensis Species 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 241000120652 Cellulomonas sp. Species 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 102100031780 Endonuclease Human genes 0.000 description 2
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 108700024394 Exon Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000004157 Hydrolases Human genes 0.000 description 2
- 108090000604 Hydrolases Proteins 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- 241000863031 Lysobacter Species 0.000 description 2
- 241001350318 Myceligenerans Species 0.000 description 2
- 108010049190 N,N-dimethylcasein Proteins 0.000 description 2
- 108091005461 Nucleic proteins Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 108010009736 Protein Hydrolysates Proteins 0.000 description 2
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 2
- 241000722261 Rarobacter Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 241001446311 Streptomyces coelicolor A3(2) Species 0.000 description 2
- 241000204060 Streptomycetaceae Species 0.000 description 2
- 241001655322 Streptomycetales Species 0.000 description 2
- 241001647802 Thermobifida Species 0.000 description 2
- 241000203780 Thermobifida fusca Species 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 241001659629 Virgibacillus Species 0.000 description 2
- 241000857071 Xylanimicrobium Species 0.000 description 2
- 241001459570 Xylanimicrobium pachnodae Species 0.000 description 2
- 241001105588 Xylanimonas Species 0.000 description 2
- ATBOMIWRCZXYSZ-XZBBILGWSA-N [1-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-3-hexadecanoyloxypropan-2-yl] (9e,12e)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C\C\C=C\CCCCC ATBOMIWRCZXYSZ-XZBBILGWSA-N 0.000 description 2
- 239000008186 active pharmaceutical agent Substances 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 2
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 230000003302 anti-idiotype Effects 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 230000003385 bacteriostatic effect Effects 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 235000013339 cereals Nutrition 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000002742 combinatorial mutagenesis Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000003795 desorption Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 230000001079 digestive effect Effects 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 235000013601 eggs Nutrition 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000006260 foam Substances 0.000 description 2
- 238000002825 functional assay Methods 0.000 description 2
- 230000001408 fungistatic effect Effects 0.000 description 2
- 229960005150 glycerol Drugs 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- BJRNKVDFDLYUGJ-RMPHRYRLSA-N hydroquinone O-beta-D-glucopyranoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC=C(O)C=C1 BJRNKVDFDLYUGJ-RMPHRYRLSA-N 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 125000005647 linker group Chemical group 0.000 description 2
- 235000013372 meat Nutrition 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- TWXDDNPPQUTEOV-FVGYRXGTSA-N methamphetamine hydrochloride Chemical compound Cl.CN[C@@H](C)CC1=CC=CC=C1 TWXDDNPPQUTEOV-FVGYRXGTSA-N 0.000 description 2
- 230000003641 microbiacidal effect Effects 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000002887 multiple sequence alignment Methods 0.000 description 2
- 239000007800 oxidant agent Substances 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 239000003531 protein hydrolysate Substances 0.000 description 2
- 230000017854 proteolysis Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 239000002453 shampoo Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 235000011178 triphosphate Nutrition 0.000 description 2
- 239000001226 triphosphate Substances 0.000 description 2
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- INMYHLJNCIBJSD-KOKHDOHPSA-N (2s)-2-aminobutanedioic acid;(2s)-2-amino-3-hydroxypropanoic acid;(2s)-2-amino-3-(1h-imidazol-5-yl)propanoic acid Chemical compound OC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CC(O)=O.OC(=O)[C@@H](N)CC1=CNC=N1 INMYHLJNCIBJSD-KOKHDOHPSA-N 0.000 description 1
- XUCIJNAGGSZNQT-JHSLDZJXSA-N (R)-amygdalin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@H](O[C@@H](C#N)C=2C=CC=CC=2)O1 XUCIJNAGGSZNQT-JHSLDZJXSA-N 0.000 description 1
- KJCVRFUGPWSIIH-UHFFFAOYSA-N 1-naphthol Chemical compound C1=CC=C2C(O)=CC=CC2=C1 KJCVRFUGPWSIIH-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- WTLKTXIHIHFSGU-UHFFFAOYSA-N 2-nitrosoguanidine Chemical compound NC(N)=NN=O WTLKTXIHIHFSGU-UHFFFAOYSA-N 0.000 description 1
- TYMLOMAKGOJONV-UHFFFAOYSA-N 4-nitroaniline Chemical compound NC1=CC=C([N+]([O-])=O)C=C1 TYMLOMAKGOJONV-UHFFFAOYSA-N 0.000 description 1
- IZSRJDGCGRAUAR-MROZADKFSA-M 5-dehydro-D-gluconate Chemical compound OCC(=O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O IZSRJDGCGRAUAR-MROZADKFSA-M 0.000 description 1
- VHTUHGNVVZPWGO-UHFFFAOYSA-N 7-(2-hydroxyethyl)-1,3-dimethyl-8-(pyridin-3-ylmethyl)purine-2,6-dione Chemical compound OCCN1C=2C(=O)N(C)C(=O)N(C)C=2N=C1CC1=CC=CN=C1 VHTUHGNVVZPWGO-UHFFFAOYSA-N 0.000 description 1
- PLXMOAALOJOTIY-FPTXNFDTSA-N Aesculin Natural products OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)[C@H]1Oc2cc3C=CC(=O)Oc3cc2O PLXMOAALOJOTIY-FPTXNFDTSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 241001147780 Alicyclobacillus Species 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241001147782 Amphibacillus Species 0.000 description 1
- 241000555286 Aneurinibacillus Species 0.000 description 1
- 241001626813 Anoxybacillus Species 0.000 description 1
- 244000105975 Antidesma platyphyllum Species 0.000 description 1
- 101100165222 Arabidopsis thaliana BETA-OHASE 1 gene Proteins 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 241000193752 Bacillus circulans Species 0.000 description 1
- 241000193749 Bacillus coagulans Species 0.000 description 1
- 241000006382 Bacillus halodurans Species 0.000 description 1
- 108010029675 Bacillus licheniformis alpha-amylase Proteins 0.000 description 1
- 241000194103 Bacillus pumilus Species 0.000 description 1
- 108010001478 Bacitracin Proteins 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 241000312098 Bogoria Species 0.000 description 1
- 101000851056 Bos taurus Elastin Proteins 0.000 description 1
- 241000149420 Bothrometopus brevis Species 0.000 description 1
- 101150111062 C gene Proteins 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 102100035882 Catalase Human genes 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 241000079871 Cellulomonas denverensis Species 0.000 description 1
- 241000814603 Cellulomonas parahominis Species 0.000 description 1
- 241000814621 Cellulomonas septica Species 0.000 description 1
- 241000079938 Cellulosimicrobium funkei Species 0.000 description 1
- WNBCMONIPIJTSB-BGNCJLHMSA-N Cichoriin Natural products O([C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1)c1c(O)cc2c(OC(=O)C=C2)c1 WNBCMONIPIJTSB-BGNCJLHMSA-N 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 241000595586 Coryne Species 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- RFSUNEUAIZKAJO-VRPWFDPXSA-N D-Fructose Natural products OC[C@H]1OC(O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-VRPWFDPXSA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- HEBKCHPVOIAQTA-QWWZWVQMSA-N D-arabinitol Chemical compound OC[C@@H](O)C(O)[C@H](O)CO HEBKCHPVOIAQTA-QWWZWVQMSA-N 0.000 description 1
- CKLJMWTZIZZHCS-UWTATZPHSA-N D-aspartic acid Chemical compound OC(=O)[C@H](N)CC(O)=O CKLJMWTZIZZHCS-UWTATZPHSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 239000003298 DNA probe Substances 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 101100449439 Drosophila melanogaster grass gene Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 101100173045 Escherichia coli (strain K12) fabD gene Proteins 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 108091060211 Expressed sequence tag Proteins 0.000 description 1
- 241000321606 Filobacillus Species 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- IECPWNUMDGFDKC-UHFFFAOYSA-N Fusicsaeure Natural products C12C(O)CC3C(=C(CCC=C(C)C)C(O)=O)C(OC(C)=O)CC3(C)C1(C)CCC1C2(C)CCC(O)C1C IECPWNUMDGFDKC-UHFFFAOYSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 229920002527 Glycogen Polymers 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 241001261512 Gracilibacillus Species 0.000 description 1
- 241000193004 Halobacillus Species 0.000 description 1
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 1
- 241000992451 Isoptericola variabilis Species 0.000 description 1
- 102220475002 Kallikrein-11_G49E_mutation Human genes 0.000 description 1
- 102220511603 Kappa-casein_R16A_mutation Human genes 0.000 description 1
- 102220511609 Kappa-casein_R16E_mutation Human genes 0.000 description 1
- 102220564806 Killer cell immunoglobulin-like receptor 2DL2_G84P_mutation Human genes 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- SHZGCJCMOBCMKK-JFNONXLTSA-N L-rhamnopyranose Chemical compound C[C@@H]1OC(O)[C@H](O)[C@H](O)[C@H]1O SHZGCJCMOBCMKK-JFNONXLTSA-N 0.000 description 1
- PNNNRSAQSRJVSB-UHFFFAOYSA-N L-rhamnose Natural products CC(O)C(O)C(O)C(O)C=O PNNNRSAQSRJVSB-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101710192606 Latent membrane protein 2 Proteins 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241000863030 Lysobacter enzymogenes Species 0.000 description 1
- 102100033448 Lysosomal alpha-glucosidase Human genes 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241000223201 Metarhizium Species 0.000 description 1
- 241000223250 Metarhizium anisopliae Species 0.000 description 1
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 1
- 102000014171 Milk Proteins Human genes 0.000 description 1
- 108010011756 Milk Proteins Proteins 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 101100446859 Moraxella nonliquefaciens tfpA gene Proteins 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 241001350321 Myceligenerans xiligouense Species 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- 102000006538 Nitric Oxide Synthase Type I Human genes 0.000 description 1
- 108010008858 Nitric Oxide Synthase Type I Proteins 0.000 description 1
- YJQPYGGHQPGBLI-UHFFFAOYSA-N Novobiocin Natural products O1C(C)(C)C(OC)C(OC(N)=O)C(O)C1OC1=CC=C(C(O)=C(NC(=O)C=2C=C(CC=C(C)C)C(O)=CC=2)C(=O)O2)C2=C1C YJQPYGGHQPGBLI-UHFFFAOYSA-N 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- AYRXSINWFIIFAE-UHFFFAOYSA-N O6-alpha-D-Galactopyranosyl-D-galactose Natural products OCC1OC(OCC(O)C(O)C(O)C(O)C=O)C(O)C(O)C1O AYRXSINWFIIFAE-UHFFFAOYSA-N 0.000 description 1
- 239000004104 Oleandomycin Substances 0.000 description 1
- RZPAKFUAFGMUPI-UHFFFAOYSA-N Oleandomycin Natural products O1C(C)C(O)C(OC)CC1OC1C(C)C(=O)OC(C)C(C)C(O)C(C)C(=O)C2(OC2)CC(C)C(OC2C(C(CC(C)O2)N(C)C)O)C1C RZPAKFUAFGMUPI-UHFFFAOYSA-N 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 241000179039 Paenibacillus Species 0.000 description 1
- 241000194109 Paenibacillus lautus Species 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 1
- 102220620755 Phosphatidylserine decarboxylase proenzyme, mitochondrial_A41N_mutation Human genes 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 241001469263 Promicromonospora aerolata Species 0.000 description 1
- 241000157935 Promicromonospora citrea Species 0.000 description 1
- 241000016278 Promicromonospora sukumoe Species 0.000 description 1
- 241001469262 Promicromonospora vindobonensis Species 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 108010066717 Q beta Replicase Proteins 0.000 description 1
- 241000722259 Rarobacter faecitabidus Species 0.000 description 1
- 108700005075 Regulator Genes Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 102000002278 Ribosomal Proteins Human genes 0.000 description 1
- 108010000605 Ribosomal Proteins Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- NGFMICBWJRZIBI-JZRPKSSGSA-N Salicin Natural products O([C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@H](CO)O1)c1c(CO)cccc1 NGFMICBWJRZIBI-JZRPKSSGSA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical group [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 241000315804 Streptomyces avermitilis MA-4680 = NBRC 14893 Species 0.000 description 1
- 241000187392 Streptomyces griseus Species 0.000 description 1
- 101001069703 Streptomyces griseus Streptogrisin-C Proteins 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- NHUHCSRWZMLRLA-UHFFFAOYSA-N Sulfisoxazole Chemical compound CC1=NOC(NS(=O)(=O)C=2C=CC(N)=CC=2)=C1C NHUHCSRWZMLRLA-UHFFFAOYSA-N 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- 101710136739 Teichoic acid poly(glycerol phosphate) polymerase Proteins 0.000 description 1
- 101710109576 Terminal protein Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 241001291204 Thermobacillus Species 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 108091061763 Triple-stranded DNA Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 241000321595 Ureibacillus Species 0.000 description 1
- 108010059993 Vancomycin Proteins 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 102220589231 WW domain-containing transcription regulator protein 1_S51D_mutation Human genes 0.000 description 1
- 241000329466 Xylanibacterium ulmi Species 0.000 description 1
- 241001105590 Xylanimonas cellulosilytica Species 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 238000011481 absorbance measurement Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 230000009603 aerobic growth Effects 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- PYMYPHUHKUWMLA-VAYJURFESA-N aldehydo-L-arabinose Chemical compound OC[C@H](O)[C@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-VAYJURFESA-N 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 108010051873 alkaline protease Proteins 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- SRBFZHDQGSBBOR-STGXQOJASA-N alpha-D-lyxopyranose Chemical compound O[C@@H]1CO[C@H](O)[C@@H](O)[C@H]1O SRBFZHDQGSBBOR-STGXQOJASA-N 0.000 description 1
- 108010028144 alpha-Glucosidases Proteins 0.000 description 1
- 108010027597 alpha-chymotrypsin Proteins 0.000 description 1
- NGFMICBWJRZIBI-UHFFFAOYSA-N alpha-salicin Natural products OC1C(O)C(O)C(CO)OC1OC1=CC=CC=C1CO NGFMICBWJRZIBI-UHFFFAOYSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229940089837 amygdalin Drugs 0.000 description 1
- YZLOSXFCSIDECK-UHFFFAOYSA-N amygdalin Natural products OCC1OC(OCC2OC(O)C(O)C(O)C2O)C(O)C(O)C1OC(C#N)c3ccccc3 YZLOSXFCSIDECK-UHFFFAOYSA-N 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 229960000271 arbutin Drugs 0.000 description 1
- 101150020960 asp gene Proteins 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 229940097012 bacillus thuringiensis Drugs 0.000 description 1
- 229960003071 bacitracin Drugs 0.000 description 1
- 229930184125 bacitracin Natural products 0.000 description 1
- CLKOFPXJLQSYAH-ABRJDSQDSA-N bacitracin A Chemical compound C1SC([C@@H](N)[C@@H](C)CC)=N[C@@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]1C(=O)N[C@H](CCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2N=CNC=2)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCCCC1 CLKOFPXJLQSYAH-ABRJDSQDSA-N 0.000 description 1
- 230000000721 bacterilogical effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000006995 beta-Glucosidase Human genes 0.000 description 1
- 108010047754 beta-Glucosidase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- DLRVVLDZNNYCBX-ZZFZYMBESA-N beta-melibiose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)O1 DLRVVLDZNNYCBX-ZZFZYMBESA-N 0.000 description 1
- 238000010364 biochemical engineering Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 238000004061 bleaching Methods 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 150000001805 chlorine compounds Chemical class 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 101150054097 chy1 gene Proteins 0.000 description 1
- 239000012459 cleaning agent Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000007621 cluster analysis Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 238000007398 colorimetric assay Methods 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 239000000645 desinfectant Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229960003276 erythromycin Drugs 0.000 description 1
- XHCADAYNFIFUHF-TVKJYDDYSA-N esculin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC(C(=C1)O)=CC2=C1OC(=O)C=C2 XHCADAYNFIFUHF-TVKJYDDYSA-N 0.000 description 1
- 229940093496 esculin Drugs 0.000 description 1
- AWRMZKLXZLNBBK-UHFFFAOYSA-N esculin Natural products OC1OC(COc2cc3C=CC(=O)Oc3cc2O)C(O)C(O)C1O AWRMZKLXZLNBBK-UHFFFAOYSA-N 0.000 description 1
- 235000020774 essential nutrients Nutrition 0.000 description 1
- YGHHWSRCTPQFFC-UHFFFAOYSA-N eucalyptosin A Natural products OC1C(O)C(O)C(CO)OC1OC1C(OC(C#N)C=2C=CC=CC=2)OC(CO)C(O)C1O YGHHWSRCTPQFFC-UHFFFAOYSA-N 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000005187 foaming Methods 0.000 description 1
- 229960004675 fusidic acid Drugs 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical compound O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- DLRVVLDZNNYCBX-CQUJWQHSSA-N gentiobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)C(O)O1 DLRVVLDZNNYCBX-CQUJWQHSSA-N 0.000 description 1
- 108010061330 glucan 1,4-alpha-maltohydrolase Proteins 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229940096919 glycogen Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 210000005255 gram-positive cell Anatomy 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 235000009424 haa Nutrition 0.000 description 1
- 239000011121 hardwood Substances 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 239000008241 heterogeneous mixture Substances 0.000 description 1
- 230000001744 histochemical effect Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 238000001155 isoelectric focusing Methods 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 229960001855 mannitol Drugs 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000001254 matrix assisted laser desorption--ionisation time-of-flight mass spectrum Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 125000000695 menaquinone group Chemical group 0.000 description 1
- 239000011676 menaquinone-4 Substances 0.000 description 1
- 239000011700 menaquinone-7 Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229960003085 meticillin Drugs 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 229960000210 nalidixic acid Drugs 0.000 description 1
- MHWLWQUZZRMNGJ-UHFFFAOYSA-N nalidixic acid Chemical compound C1=C(C)N=C2N(CC)C=C(C(O)=O)C(=O)C2=C1 MHWLWQUZZRMNGJ-UHFFFAOYSA-N 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229960000564 nitrofurantoin Drugs 0.000 description 1
- NXFQHRVNIOXGAQ-YCRREMRBSA-N nitrofurantoin Chemical compound O1C([N+](=O)[O-])=CC=C1\C=N\N1C(=O)NC(=O)C1 NXFQHRVNIOXGAQ-YCRREMRBSA-N 0.000 description 1
- 229960002950 novobiocin Drugs 0.000 description 1
- YJQPYGGHQPGBLI-KGSXXDOSSA-M novobiocin(1-) Chemical compound O1C(C)(C)[C@H](OC)[C@@H](OC(N)=O)[C@@H](O)[C@@H]1OC1=CC=C(C([O-])=C(NC(=O)C=2C=C(CC=C(C)C)C(O)=CC=2)C(=O)O2)C2=C1C YJQPYGGHQPGBLI-KGSXXDOSSA-M 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 229960002351 oleandomycin Drugs 0.000 description 1
- RZPAKFUAFGMUPI-KGIGTXTPSA-N oleandomycin Chemical compound O1[C@@H](C)[C@H](O)[C@@H](OC)C[C@@H]1O[C@@H]1[C@@H](C)C(=O)O[C@H](C)[C@H](C)[C@H](O)[C@@H](C)C(=O)[C@]2(OC2)C[C@H](C)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C RZPAKFUAFGMUPI-KGIGTXTPSA-N 0.000 description 1
- 235000019367 oleandomycin Nutrition 0.000 description 1
- 229940124276 oligodeoxyribonucleotide Drugs 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- BJRNKVDFDLYUGJ-UHFFFAOYSA-N p-hydroxyphenyl beta-D-alloside Natural products OC1C(O)C(O)C(CO)OC1OC1=CC=C(O)C=C1 BJRNKVDFDLYUGJ-UHFFFAOYSA-N 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229940056360 penicillin g Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 150000008300 phosphoramidites Chemical class 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 238000013379 physicochemical characterization Methods 0.000 description 1
- 210000002706 plastid Anatomy 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000000379 polymerizing effect Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 230000022558 protein metabolic process Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000000734 protein sequencing Methods 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 108010058004 pyrazinamide deamidase Proteins 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 239000013557 residual solvent Substances 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 239000011369 resultant mixture Substances 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- JQXXHWHPUNPDRT-WLSIYKJHSA-N rifampicin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 102220057261 rs148538950 Human genes 0.000 description 1
- 102220274429 rs1489673789 Human genes 0.000 description 1
- 102220045134 rs56026142 Human genes 0.000 description 1
- 102220024416 rs59793293 Human genes 0.000 description 1
- 102220096854 rs876660119 Human genes 0.000 description 1
- 102220308694 rs963128995 Human genes 0.000 description 1
- NGFMICBWJRZIBI-UJPOAAIJSA-N salicin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC=CC=C1CO NGFMICBWJRZIBI-UJPOAAIJSA-N 0.000 description 1
- 229940120668 salicin Drugs 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 239000013049 sediment Substances 0.000 description 1
- 238000004062 sedimentation Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 150000003355 serines Chemical class 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 238000002791 soaking Methods 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 235000011008 sodium phosphates Nutrition 0.000 description 1
- 229910052938 sodium sulfate Inorganic materials 0.000 description 1
- 235000011152 sodium sulphate Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 229960002920 sorbitol Drugs 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 229960000654 sulfafurazole Drugs 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 150000003505 terpenes Chemical class 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000005382 thermal cycling Methods 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 229960001082 trimethoprim Drugs 0.000 description 1
- IEDVJHCEMCRBQM-UHFFFAOYSA-N trimethoprim Chemical compound COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 IEDVJHCEMCRBQM-UHFFFAOYSA-N 0.000 description 1
- 125000002264 triphosphate group Chemical class [H]OP(=O)(O[H])OP(=O)(O[H])OP(=O)(O[H])O* 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 239000006150 trypticase soy agar Substances 0.000 description 1
- RULSWEULPANCDV-PIXUTMIVSA-N turanose Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](C(=O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O RULSWEULPANCDV-PIXUTMIVSA-N 0.000 description 1
- 108010087967 type I signal peptidase Proteins 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 229960003165 vancomycin Drugs 0.000 description 1
- MYPYJXKWCTUITO-LYRMYLQWSA-O vancomycin(1+) Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C([O-])=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)[NH2+]C)[C@H]1C[C@](C)([NH3+])[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-O 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 235000019143 vitamin K2 Nutrition 0.000 description 1
- 239000011728 vitamin K2 Substances 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
Definitions
- the present invention provides novel serine proteases, novel genetic material encoding these enzymes, and proteolytic proteins obtained from Micrococcineae spp., including but not limited to Cellulomonas spp. and variant proteins developed therefrom.
- the present invention provides protease compositions obtained from a Cellulomonas spp, DNA encoding the protease, vectors comprising the DNA encoding the protease, host cells transformed with the vector DNA, and an enzyme produced by the host cells.
- the present invention also provides cleaning compositions (e.g., detergent compositions), animal feed compositions, and textile and leather processing compositions comprising protease(s) obtained from a Micrococcineae spp., including but not limited to Cellulomonas spp.
- cleaning compositions e.g., detergent compositions
- animal feed compositions e.g., animal feed compositions
- textile and leather processing compositions comprising protease(s) obtained from a Micrococcineae spp., including but not limited to Cellulomonas spp.
- mutant proteases derived from the wild-type proteases described herein. These mutant proteases also find use in numerous applications.
- Serine proteases are a subgroup of carbonyl hydrolases comprising a diverse class of enzymes having a wide range of specificities and biological functions (See e.g., Stroud, Sci. Amer., 131 :74-88). Despite their functional diversity, the catalytic machinery of serine proteases has been approached by at least two genetically distinct families of enzymes: 1) the subtilisins; and 2) the mammalian chymotrypsin-related and homologous bacterial serine proteases (e.g., trypsin and S. g seus trypsin).
- subtilisins and chymotrypsin-related serine proteases both have a catalytic triad comprising aspartate, histidine and serine.
- subtilisin-related proteases the relative order of these amino acids, reading from the amino to carboxy terminus, is aspartate-histidine-serine.
- the present invention provides novel serine proteases, novel genetic material encoding these enzymes, and proteolytic proteins obtained from Micrococcineae spp., including but not limited to Cellulomonas spp. and variant proteins developed therefrom.
- the present invention provides protease compositions obtained from a Cellulomonas spp, DNA encoding the protease, vectors comprising the DNA encoding the protease, host cells transformed with the vector DNA, and an enzyme produced by the host cells.
- the present invention also provides cleaning compositions (e.g., detergent compositions), animal feed compositions, and textile and leather processing compositions comprising protease(s) obtained from a Micrococcineae spp., including but not limited to Cellulomonas spp.
- cleaning compositions e.g., detergent compositions
- animal feed compositions e.g., animal feed compositions
- textile and leather processing compositions comprising protease(s) obtained from a Micrococcineae spp., including but not limited to Cellulomonas spp.
- mutant proteases derived from the wild-type proteases described herein. These mutant proteases also find use in numerous applications.
- the present invention provides isolated serine proteases obtained from a member of the Micrococcineae. In some embodiments, the proteases are cellulomonadins.
- the protease is obtained from an organism selected from the group consisting of Cellulomonas, Oerskovia, Cellulosimicrobium, Xylanibacterium, and Promicromonospora. In some particularly preferred embodiments, the protease is obtained from Cellulomonas 69B4. In further embodiments, the protease comprises the amino acid sequence set forth in SEQ ID NO:8. In additional embodiments, the present invention provides isolated serine proteases comprising at least 45% amino acid identity with serine protease comprising SEQ ID NO:8.
- the isolated serine proteases comprise at least 50% identity, preferably at least 55%, more preferably at least 60%, yet more preferably at least 65%, even more preferably at least 70%, more preferably at least 75%, still more preferably at least 80%, more preferably 85%, yet more preferably 90%, even more preferably at least 95%, and most preferably 99% identity.
- the present invention also provides compositions comprising isolated serine proteases having immunological cross-reactivity with the serine proteases obtained from the Micrococcineae.
- the serine proteases have immunological cross-reactivity with serine protease obtained from Cellulomonas 69B4.
- the serine proteases have immunological cross-reactivity with serine protease comprising the amino acid sequence set forth in SEQ ID NO:8.
- the serine proteases have cross-reactivity with fragments (i.e., portions) of any of the serine proteases obtained from the Micrococcineae, the
- the present invention provides the amino acid sequence set forth in SEQ ID NO:8, wherein the sequence comprises substitutions at least one amino acid position selected from the group comprising positions 2, 8, 10, 11 , 12, 13, 14, 15, 16, 24, 26, 31 , 33, 35, 36, 38, 39, 40, 43, 46, 49, 51 , 54, 61 , 64, 65, 67, 70, 71 , 76, 78, 79, 81 , 83, 85, 86, 90, 93, 99, 100, 105, 107, 109, 112, 113, 116, 118, 119, 121 , 123, 127, 145, 155, 159, 160, 163, 165, 170, 174, 179, 183, 184, 185, 186, 187, and 188.
- the sequence comprises substitutions at least one amino acid position selected from the group comprising positions 1 , 4, 22, 27, 28, 30, 32, 41 , 47, 48, 55, 59, 63, 66, 69, 75, 77, 80, 84, 87, 88, 89, 92, 96, 110, 111 , 114, 115, 117, 128, 134, 144, 143, 146, 151 , 154, 156, 158, 161 , 166, 176, 177, 181 , 182, 187, and 189.
- the present invention provides protease variants having an amino acid sequence comprising at least one substitution of an amino acid made at a position equivalent to a position in a Cellulomonas 69B4 protease comprising the amino acid sequence set forth in SEQ ID NO:8.
- the present invention provides protease variants having an amino acid sequence comprising at least one substitution of an amino acid made at a position equivalent to a position in a Cellulomonas 69B4 protease comprising at least a portion of SEQ ID NO:8.
- the substitutions are made at positions equivalent to positions 2, 8, 10, 11 , 12, 13, 14, 15, 16, 24, 26, 31 , 33, 35, 36, 38, 39, 40, 43, 46, 49, 51 , 54, 61 , 64, 65, 67, 70, 71 , 76, 78, 79, 81 , 83, 85, 86, 90, 93, 99, 100, 105, 107, 109, 112, 113, 116, 118, 119, 121 , 123, 127, 145, 155, 159, 160, 163, 165, 170, 174, 179, 183, 184, 185, 186, 187, and 188 in a Cellulomonas 69B4 protease having an amino acid sequence set forth in SEQ ID NO:8.
- substitutions are made at positions equivalent to positions 1, 4, 22, 27, 28, 30, 32, 41 , 47, 48, 55, 59, 63, 66, 69, 75, 77, 80, 84, 87, 88, 89, 92, 96, 110, 111 , 114, 115, 117, 128, 134, 144, 143, 146, 151 , 154, 156, 158, 161 , 166, 176, 177, 181 , 182, 187, and 189, in a Cellulomonas 69B4 protease having an amino acid sequence set forth in SEQ ID NO:8.
- the protease variants comprise the amino acid sequence comprising SEQ ID NO:8, wherein at least one amino acid position at positions selected from the group consisting of 14, 16, 35, 36, 65, 75, 76, 79, 123, 127, 159, and 179, are substituted with another amino acid.
- the proteases comprise at least one mutation selected from the group consisting of R14L, R16I, R16L, R16Q, R35F, T36S, G65Q, Y75G, N76L, N76V, R79T, R123L, R123Q, R127A, R127K, R127Q, R159K, R159Q, and R179Q.
- the proteases comprise multiple mutations selected from the group consisting of R16Q/R35F/R159Q, R16Q/R123L, R14LJR127Q/R159Q, R14UR179Q, R123LJR127Q/R179Q, R16Q/R79T/R127Q, and R16Q/R79T. In some particularly preferred embodiments, the proteases comprise the following mutations R123L, R127Q, and R179Q.
- the present invention also provides protease variants having amino acid sequences comprising at least one substitution selected from the group consisting of T36I, A38R, N170Y, N73T, G77T, N24A, T36G, N24E, L69S, T36N, T36S, E119R, N74G, T36W, S76W, N24T, N24Q, T36P, S76Y, T36H, G54D, G78A, S187P, R179V, N24V, V90P, T36D, L69H, G65P, G65R, N7L, W103M, N55F, G186E, A70H, S76V, G186V, R159F, T36Y, T36V, G65V, N24M, S51A, G65Y, Q71 I, V66H, P118A, T116F, A38F, N24H, V66D, S76L, G177M, G186I, H85Q, Q71 K,
- these variants have improved casein hydrolysis performance as compared to wild-type Cellulomonas 69B4 protease.
- the present invention also provides protease variants having amino acid sequences comprising at least one substitution selected from the group consisting of R35E, R35D, R14E, R14D, Q167E, G49C, S15R, S15H, I11W, S15C, G49Q, R35Q, R35V, G49E, R123D, R123Y, G49H, A38D, R35S, F47R, R123C, T151 L, R14T, R35T, R123E, G49A, G49V, D56L, R35N, R35A, G12D, R35C, R123N, T46V, R123H, S155C, T121 E, R127E, S113C, R123T, R16E, T46F, T121L, A38C, T46E, R123W, T44E,
- the protease variants have amino acid sequences comprising at least one substitution selected from the group consisting of S99G, T100K, R127A, F1 P, S155V, T128A, F165H, G177E, A70M, S140P, A87E, D2I, R159K, T36V, R179C, E119N, T10Y, I172A, A8T, F47V, W103L, R61 K, D2V, R179V, D2T, R159N, E119A, G54E, R16Q, G49S, R16I, S51 L, S155E, S15M, R179I, T10Q, G12H, R159C, R179T, T163C, R159A, A132S, N157D, G13E, L141 M, A41T, R123M, R14M, A8R, Q81 P, N24T, T10D, A88F, R61Q, S99K, R179Y
- these variants have improved LAS stability as compared to wild-type Cellulomonas 69B4 protease.
- the present invention also provides protease variants having amino acid sequences comprising at least one substitution selected from the group consisting of G26I, G26K,
- the protease variants have amino acid sequences comprising at least one substitution selected from the group consisting of S188E, S188V, Y117K, Y117Q, Y117R, Y117V, R127K, R127Q, R123L, T86S, R123I, Q81 E, L125M, H32A, S188T, N74F, C33D, F27I, A83M, Q71Y, R123T, V90A, F59W, L141C, N170E, T46F, S51V, G162P,
- these variants have improved thermostability as compared to wild-type Cellulomonas 69B4 protease.
- the present invention also provides protease variants having amino acid sequences comprising at least one substitution selected from the group consisting of T36I, I172T, N24E, N170Y, G77T, G186N, 1181 L, N73T, A38R, N74G, N24A, G54D, S76D, R123E, 159E, N112E, R35E, R179V, R123D, N24T, R179T, R14L, A38D, V90P, R14Q, R123I, R179D, S76V, R79G, R35L, S76E, S76Y, R79D, R79P, R35Q, R179N, N112D, R179E, G65P, Y75G, V90S, R179M, R35F, R123F, A64I, N24Q, R
- the protease variants have amino acid sequences comprising at least one substitution selected from the group consisting of G65L, S99D, T107M, S113T, S99T, G77S, R14M, A64N, R61M, A70D, Q71G, A93D, S92G, N112Y, S15W, R159K, N67G, T10E, R127H, A64Y, R159C, A38L, T160E, T183E, R127S, A8E, S51Q, N7L, G63D, A38S, R35H, R14K, T107I, G12D, A64L, S76W, A41N, R35M, A64V, A38Y, T183I, W103M, A41D, R127K, T36D, R61T, G65Y, G13S, R35Y, R123T, A64H, G49H, A70H, A64F, R127Y, R61 E,
- these variants have improved keratin hydrolysis activity as compared to wild-type Cellulomonas 69B4 protease.
- the present invention also provides protease variants having amino acid sequences comprising at least one substitution selected from the group consisting of T36I, P89D, A93T, A93S, T36N, N73T, T36G, R159F, T36S, A38R, S99W, S76W, T36P, G77T, G54D, R127A, R159E, H85Q, T36D, S76L, S99N, Y75G, S76Y, R127S, N24E, R127Q, D184F, N170Y, N24A, S76T, H85L, Y75F, S76V, L69S, R159K, R127K, G65P, N74G, R159H, G65Q, G186V, A48Q, T36H, N67L, R14I, R127L
- these variants have improved BMI performance as compared to wild-type Cellulomonas 69B4 protease.
- the present invention also provides protease variants having amino acid sequences comprising at least one substitution selected from the group consisting of T36I, N170Y, A38R, R79P, G77T, L69S, N73T, S76V, S76Y, R179V, T36N, N55F, R159F, G54D, G65P, L69H, T36G, G177M, N24E, N74G, R159E, T36S, Y75G, S76I, S76D, A8R, A24A, V90P, R159C, G65Q, T121 E, A8V, S76L, T109E, R179M, A8T, T107N, G186E, S76W, R123E, A38F, T36P, N67G, Y75F, S76N, R179I, S187P
- the protease variants have amino acid sequences comprising at least one substitution selected from the group consisting of G186I, A64Q, T109G, G64L, N24L, A8E, N112D, A38H, R179W, S114G, R123L, A8L, T129S, N170D, R159N, N67C, S92C, T107A, G54E, T107E, T36V, R127T, A8N, H85L, A110S, N170C, A64R, A132V, T36Y, G63D, W103M, T151V, R123P, W103Y, S76T, S187T, R127F, N67A, P171 M, A70S, R159H, S76Q, L125V, G54Q, G49L, R14I, R14Q, A83I, V90L, T183E, R159A, T101S, G65D, G54A, T107Q, Q
- these variants have improved BMI performance under low pH conditions, as compared to wild-type Cellulomonas 69B4 protease. . .
- the present invention also provides serine proteases comprising at least a portion of an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:9.
- the nucleotide sequences encoding these serine proteases comprise a nucleotide sequence selected from the group consisting of SEQ ID NO:1 , SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, and SEQ ID NO:5.
- the serine proteases are variants having amino acid sequences that are similar to that set forth in SEQ ID NO:8.
- the proteases are obtained from a member of the Micrococcineae.
- the proteases are obtained from an organism selected from the group consisting of Cellulomonas, Oerskovia, Cellulosimicrobium, Xylanibacterium, and Promicromonospora.
- the protease is obtained from variants of Cellulomonas 69B4.
- the present invention also provides isolated protease variants having amino acid sequences comprising at least one substitution of an amino acid made at a position equivalent to a position in a Cellulomonas 69B4 protease comprising the amino acid sequence set forth in SEQ ID NO:8, wherein the amino acid of the protease comprises Arg14, Ser15, Arg16, Cys17, His32, Cys33, Phe52, Asp56, Thr100, Val115, Thr116, Tyr117, Pro118, Glu119, Ala132, Glu133, Pro134, Gly135, Asp136, Ser137, Thr151, Ser152, Gly153, Gly154, Ser155, Gly156, Asn157, Thr164, and Phe165.
- the catalytic triad of the proteases comprises His 32, Asp56, and Ser137.
- the proteases comprise Cys131 , Ala132, Glu133, Pro134, Gly135, Thr151 , Ser152, Gly153, Gly154, Ser155, Gly156, Asn157 and Gly 162, Thr 163, and Thr164.
- the amino acid sequence of the proteases comprise Phe52, Tyr117, Pro118 and Glu119.
- the amino acids sequences of the proteases have main-chain to main-chain hydrogen bonding from Gly 154 to the substrate main-chain.
- the proteases of the present invention comprise three disulfide bonds.
- the disulfide bonds are located between C17 and C38, C95 and C105, and C131 and C158. In some particularly preferred embodiments, the disulfide bonds are located between C17 and C38, C95 and C105, and C131 and C158 of SEQ ID NO:8. In alternative protease variant embodiments, the disulfide bonds are located at positions equivalent to the disulfide bonds in SEQ ID NO:8.
- the present invention also provides isolated protease variants having amino acid sequences comprising at least one substitution of an amino acid made at a position equivalent to a position in a Cellulomonas 69B4 protease comprising the amino acid sequence set forth in SEQ ID NO:8, wherein the variants have altered substrate specificities as compared to wild-type Cellulomonas 69B4 protease.
- the variants have altered pis as compared to wild-type Cellulomonas 69B4 protease.
- the variants have improved stability as compared to wild-type Cellulomonas 69B4 protease.
- the variants exhibit altered surface properties.
- the variants exhibit altered surface properties as compared to wild-type Cellulomonas 69B4 protease.
- the variants comprise mutations at least one substitution at sites selected from the group consisting of 1 , 2, 4, 7, 8, 10, 11 , 12, 13, 14, 15, 16, 22, 24, 25, 32, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 57, 59, 61 , 62, 63, 64, 65, 66, 67, 68, 69, 71 , 73, 74, 75, 76, 77, 78, 79, 80, 81 , 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 95, 99, 100, 101 , 102, 103, 104, 105, 106, 107, 108, 109
- the present invention also provides protease variants having at least one improved property as compared to the wild-type protease.
- the variants are variants of a serine protease obtained from a member of the Micrococcineae.
- the proteases are obtained from an organism selected from the group consisting of Cellulomonas, Oerskovia, Cellulosimicrobium, Xylanibacterium, and Promicromonospora.
- the protease is obtained from variants of Cellulomonas 69B4.
- At least one improved property is selected from the group consisting of acid stability, thermostability, casein hydrolysis, keratin hydrolysis, cleaning performance, and LAS stability.
- the present invention also provides expression vectors comprising a polynucleotide sequence encoding protease variants having amino acid sequences comprising at least one substitution of an amino acid made at a position equivalent to a position in a Cellulomonas 69B4 protease comprising the amino acid sequence set forth in SEQ ID NO:8.
- the present invention provides host cells comprising these expression vectors.
- the host cells are selected from the group consisting of Bacillus sp., Streptomyces sp., Aspergillus sp., and Trichoderma sp.
- the present invention also provides the serine proteases produced by the host cells.
- the present invention also provides variant proteases comprising an amino acid sequence selected from the group consisting of SEQ ID NOS:54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, and 78,
- the amino acid sequence is encoded by a polynucleotide sequence selected from the group consisting of SEQ ID NOS:53, 55, 57, 59, 61 , 63, 65, 67, 69, 71, 73, 75, and 77.
- the present invention provides expression vectors comprising a polynucleotide sequence encoding at least one protease variant.
- the present invention provides host cells comprising these expression vectors.
- the host cells are selected from the group consisting of Bacillus sp., Streptomyces sp., Aspergillus sp., and Trichoderma sp.
- the present invention also provides the serine proteases produced by the host cells.
- the present invention also provides compositions comprising at least a portion of an isolated serine protease of obtained from a member of the Micrococcineae, wherein the protease is encoded by a polynucleotide sequence selected from the group consisting of SEQ ID NO:1 , SEQ ID NO:2, SEQ ID NO:3, and SEQ ID NO:4.
- the sequence comprises at least a portion of SEQ ID NO:1.
- the present invention provides host cells comprising these expression vectors.
- the host cells are selected from the group consisting of Bacillus sp., Streptomyces sp., Aspergillus sp., and Trichoderma sp.
- the present invention also provides the serine proteases produced by the host cells.
- the present invention also provides variant serine proteases, wherein the proteases comprise at least one substitution corresponding to the amino acid positions in SEQ ID NO:8, and wherein variant proteases have better performance in at least one property selected from the group consisting of keratin hydrolysis, thermostability, casein activity, LAS stability, and cleaning, as compared to wild-type Cellulomonas 69B4 protease.
- the present invention also provides isolated polynudeotides comprising a nucleotide sequence (i) having at least 70% identity to SEQ ID NO:4, or (ii) being capable of hybridizing to a probe derived from the nucleotide sequence set forth in SEQ ID NO:4, under conditions of intermediate to high stringency, or (iii) being complementary to the nucleotide sequence set forth in SEQ ID NO:4.
- the present invention provides expression vectors encoding at least one such polynucleotide.
- the present invention provides host cells comprising these expression vectors.
- the host cells are selected from the group consisting of Bacillus sp., Streptomyces sp., Aspergillus sp., and Trichoderma sp.
- the present invention also provides the serine proteases produced by the host cells.
- the present invention provides polynudeotides that are complementary to at least a portion of the sequence set forth in SEQ ID NO:4.
- the present invention also provides methods of producing an enzyme having protease activity, comprising: transforming a host cell with an expression vector comprising a polynucleotide having at least 70% sequence identity to SEQ ID NO:4; cultivating the transformed host cell under conditions suitable for host cell.
- the host cell is selected from the group consisting of Streptomyces, Aspergillus, Trichoderma and Bacillus species.
- the present invention also provides probes comprising 4 to 150 nucleotide sequence substantially identical to a corresponding fragment of SEQ ID NO:4, wherein the probe is used to detect a nucleic acid sequence coding for an enzyme having proteolytic activity, and wherein the nucleic acid sequence is obtained from a member of the Micrococcineae.
- the Micrococcineae is a Cellulomonas spp.
- the Cellulomonas is Cellulomonas strain 69B4.
- the present invention also provides cleaning compositions comprising at least one serine protease obtained from a member of the Micrococcineae.
- ate least one protease is obtained from an organism selected from the group consisting of
- the protease is obtained from Cellulomonas 69B4.
- at least one protease comprises the amino acid sequence set forth in SEQ ID NO:8.
- the present invention provides isolated serine proteases comprising at least 45% amino acid identity with serine protease comprising SEQ ID NO:8.
- the isolated serine proteases comprise at least 50% identity, preferably at least 55%, more preferably at least 60%, yet more preferably at least 65%, even more preferably at least 70%, more preferably at least 75%, still more preferably at least 80%, more preferably 85%, yet more preferably 90%, even more preferably at least 95%, and most preferably 99% identity.
- the present invention further provides cleaning compositions comprising at least one serine protease, wherein at least one of the serine proteases has immunological cross- reactivity with the serine protease obtained from a member of the Micrococcineae.
- the serine proteases have immunological cross- reactivity with serine protease obtained from Cellulomonas 69B4. In alternative embodiments, the serine proteases have immunological cross-reactivity with serine protease comprising the amino acid sequence set forth in SEQ ID NO:8. In still further embodiments, the serine proteases have cross-reactivity with fragments (i.e., portions) of any of the serine proteases obtained from the Micrococcineae, the Cellulomonas 69B4 protease, and/or serine protease comprising the amino acid sequence set forth in SEQ ID NO:8.
- the present invention further provides cleaning compositions comprising at least one serine protease, wherein the protease is a variant protease having an amino acid sequence comprising at least one substitution of an amino acid made at a position equivalent to a position in a Cellulomonas 69B4 protease having an amino acid sequence set forth in SEQ ID NO:8.
- the substitutions are made at positions equivalent to positions 2, 8, 10, 11 , 12, 13, 14, 15, 16, 24, 26, 31 , 33, 35, 36, 38, 39, 40, 43, 46, 49, 51 , 54, 61 , 64, 65, 67, 70, 71 , 76, 78, 79, 81 , 83, 85, 86, 90, 93, 99, 100, 105, 107, 109, 112, 113, 116, 118, 119, 121 , 123, 127, 145, 155, 159, 160, 163, 165, 170, 174, 179, 183, 184, 185, 186, 187, and 188 in a Cellulomonas 69B4 protease comprising an amino acid sequence set forth in SEQ ID NO:8.
- substitutions are made at positions equivalent to positions 1 , 4, 22, 27, 28, 30, 32, 41 , 47, 48, 55, 59, 63, 66, 69, 75, 77, 80, 84, 87, 88, 89, 92, 96, 110, 11 1 , 114, 115, 117, 128, 134, 144, 143, 146, 151 , 154, 156, 158, 161 , 166, 176, 177, 181 , 182, 187, and 189, in a Cellulomonas 69B4 protease comprising an amino acid sequence set forth in SEQ ID NO:8.
- the protease comprises at least one amino acid substitutions at positions 14, 16, 35, 36, 65, 75, 76, 79, 123, 127, 159, and 179, in an equivalent amino acid sequence to that set forth in SEQ ID NO:8.
- the protease comprises at least one mutation selected from the group consisting of R14L, R16I, R16L, R16Q, R35F, T36S, G65Q, Y75G, N76L, N76V, R79T, R123L, R123Q, R127A, R127K, R127Q, R159K, R159Q, and R179Q.
- the protease comprises a set of mutations selected from the group consisting of the sets R16Q/R35F/R159Q, R16Q/R123L, R14L/R127Q/R159Q, R14L/R179Q, R123L/R127Q/R179Q, R16Q/R79T/R127Q, and R16Q/R79T.
- the protease comprises the following mutations R123L, R127Q, and R179Q.
- the variant serine proteases comprise at least one substitution corresponding to the amino acid positions in SEQ ID NO:8, and wherein the variant proteases have better performance in at least one property selected from the group consisting of keratin hydrolysis, thermostability, casein activity, LAS stability, and cleaning, as compared to wild-type Cellulomonas 69B4 protease.
- the variant protease comprises an amino acid sequence selected from the group consisting of SEQ ID NOS:54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, and 78.
- the variant protease amino acid sequence is encoded by a polynucleotide sequence selected from the group consisting of SEQ ID NOS:53, 55, 57, 59, 61 , 63, 65, 67, 69, 71 , 73, 75, and 77.
- the present invention also provides cleaning compositions comprising a cleaning effective amount of a proteolytic enzyme, the enzyme comprising an amino acid sequence having at least 70 % sequence identity to SEQ ID NO:4, and a suitable cleaning formulation.
- the cleaning compositions further comprise one or more additional enzymes or enzyme derivatives selected from the group consisting of proteases, amylases, lipases, mannanases, pectinases, cutinases, oxidoreductases, hemicellulases, and cellulases.
- the present invention also provides compositions comprising at least one serine protease obtained from a member of the Micrococcineae, wherein the compositions further comprise at least one stabilizer.
- the stabilizer is selected from the group consisting of borax and glycerol.
- the present invention provides competitive inhibitors suitable to stabilize the enzyme of the present invention to anionic surfactants.
- At least one protease is obtained from an organism selected from the group consisting of Cellulomonas, Oerskovia, Cellulosimicrobium, Xylanibacterium, and Promicromonospora.
- the protease is obtained from Cellulomonas 69B4.
- at least one protease comprises the amino acid sequence set forth in SEQ ID NO:8.
- the present invention further provides compositions comprising at least one serine protease obtained obtained from a member of the Micrococcineae, wherein the serine protease is an autolytically stable variant.
- At least one variant protease is obtained from an organism selected from the group consisting of Cellulomonas, Oerskovia, Cellulosimicrobium, Xylanibacterium, and Promicromonospora.
- the variant protease is obtained from Cellulomonas 69B4.
- at least one variant protease comprises the amino acid sequence set forth in SEQ ID NO:8.
- the present invention also provides cleaning compositions comprising at least 0.0001 weight percent of the serine protease of the present invention, and optionally, an adjunct ingredient.
- the composition comprises an adjunct ingredient.
- the composition comprises a sufficient amount of a pH modifier to provide the composition with a neat pH of from about 3 to about 5, the composition being essentially free of materials that hydrolyze at a pH of from about 3 to about 5.
- the materials that hydrolyze comprise a surfactant material.
- the cleaning composition is a liquid composition.
- the surfactant material comprises a sodium alkyl sulfate surfactant that comprises an ethylene oxide moiety.
- the present invention additionally provides cleaning compositions that comprise at least one acid stable enzyme, the cleaning composition comprising a sufficient amount of a pH modifier to provide the composition with a neat pH of from about 3 to about 5, the composition being essentially free of materials that hydrolyze at a pH of from about 3 to about 5.
- the materials that hydrolyze comprise a surfactant material.
- the cleaning composition being a liquid composition.
- the surfactant material comprises a sodium alkyl sulfate surfactant that comprises an ethylene oxide moiety.
- the cleaning composition comprises a suitable adjunct ingredient.
- the composition comprises a suitable adjunct ingredient.
- the composition comprises from about 0.001 to about 0.5 weight % of ASP.
- the composition comprises from about 0.01 to about 0.1 weight percent of ASP.
- the present invention also provides methods of cleaning, the comprising the steps of: a) contacting a surface and/or an article comprising a fabric with the cleaning composition comprising the serine protease of the present invention at an appropriate concentration; and b) optionally washing and/or rinsing the surface or material.
- any suitable composition provided herein finds use in these methods.
- the present invention also provides animal feed comprising at least one serine protease obtained from a member of the Micrococcineae.
- At least one protease is obtained from an organism selected from the group consisting of Cellulomonas, Oerskovia, Cellulosimicrobium, Xylanibacterium, and Promicromonospora.
- the protease is obtained from Cellulomonas 69B4.
- at least one protease comprises the amino acid sequence set forth in SEQ ID NO:8.
- the present invention provides an isolated polypeptide having proteolytic activity, (e.g., a protease) having the amino acid sequence set forth in SEQ ID NO:8.
- the present invention provides isolated polypeptides having approximately 40% to 98% identity with the sequence set forth in SEQ ID NO:8.
- the polypeptides have approximately 50% to 95% identity with the sequence set forth in SEQ ID NO:8. In some additional preferred embodiments, the polypeptides have approximately 60% to 90% identity with the sequence set forth in SEQ ID NO:8. In yet additional embodiments, the polypeptides have approximately 65% to 85% identity with the sequence set forth in SEQ ID NO:8. In some particularly preferred embodiments, the polypeptides have approximately 90% to 95% identity with the sequence set forth in SEQ ID NO:8.
- the present invention further provides proteases obtained from bacteria of the suborder Micrococcineae. In some preferred embodiments, the proteases are obtained from members of the family Promicromonosporaceae.
- the proteases are obtained from any member of the genera Xylanimicrobium, Xylanibacterium, Xylanimonas, Myceligenerans, and Promicromonospora. In some preferred embodiments, the proteases are obtained from members of the family Cellulomonadaceae. In some particularly preferred embodiments, the proteases are obtained from members of the genera Cellulomonas and Oerskovia. In some further preferred embodiments, the proteases are derived from Cellulomonas spp. In some embodiments, the Cellulomonas spp.
- Cellulomonas fimi is selected from Cellulomonas fimi, Cellulomonas biazotea, Cellulomonas cellasea, Cellulomonas hominis, Cellulomonas flavigena, Cellulomonas persica, Cellulomonas iranensis, Cellulomonas gelida, Cellulomonas humilata, Cellulomonas turbata, Cellulomonas uda, Cellulomonas fermentans, Cellulomonas xylanilytica, Cellulomonas humilata and Cellulomonas strain 69B4 (DSM 16035).
- the proteases are derived from Oerskovia spp.
- the Oerskovia spp. is selected from Oerskovia réellensis, Oerskovia paurometabola, Oerskovia enterophila, Oerskovia turbata and Oerskovia turbata strain DSM 20577.
- the proteases have apparent molecular weights of about 17kD to 21 kD as determined by a matrix assisted laser desorption/ionizaton - time of flight ("M ALD I -TO F") spectrophotom eter.
- M ALD I -TO F matrix assisted laser desorption/ionizaton - time of flight
- the present invention further provides isolated polynudeotides that encode proteases comprise an amino acid sequence comprising at least 40% amino acid sequence identity to SEQ ID NO:8.
- the proteases have at least 50% amino acid sequence identity to SEQ ID NO:8.
- the proteases have at least 60% amino acid sequence identity to SEQ ID NO:8.
- the proteases have at least 70% amino acid sequence identity to SEQ ID NO:8.
- 5 the proteases have at least 80% amino acid sequence identity to SEQ ID NO:8.
- the proteases have at least 90% amino acid sequence identity to SEQ ID NO:8.
- the proteases have at least 95% amino acid sequence identity to SEQ ID NO:8.
- the present invention also provides expression vectors comprising any of the polynudeotides provided above.o
- the present invention further provides host cells transformed with the expression vectors of the present invention, such that at least one protease is expressed by the host cells.
- the host cells are bacteria, while in other embodiments, the host cells are fungi.
- the bacterial host cells are selected from the group consisting of the genera Bacillus and Streptomyces:
- the fungal host cells are members of the genus Trichoderma, while in other alternative preferred embodiments, the fungal host cells are members of the genus Aspergillus.
- the present invention also provides isolated polynudeotides comprising a nucleotide sequence (i) having at least 70% identity to SEQ ID NOS:3 or 4, or (ii) being capable ofo hybridizing to a probe derived from the nucleotide sequence disclosed in SEQ ID NOS: 3 or 4, under conditions of medium to high stringency, or (iii) being complementary to the nucleotide sequence disclosed in SEQ ID NOS:3 or 4.
- the present invention provides vectors comprising such polynucleotide.
- the present invention provides host cells transformed with such vector.5
- the present invention further provides methods for producing at least one enzyme having protease activity, comprising: the steps of transforming a host cell with an expression vector comprising a polynucleotide comprising at least 70% sequence identity to SEQ ID NO:4, cultivating the transformed host cell under conditions suitable for the host cell to produce the protease; and recovering the protease.
- theo host cell is a Streptomyces spp, while in other embodiments, the host cell is a Bacillus spp,, a Trichoderma spp., and/or a Aspergillus spp. In some embodiments, the Streptomyces spp.
- the present invention also provides fragments (i.e., portions) of the DNA encoding5 the proteases provided herein. These fragments find use in obtaining partial length DNA fragments capable of being used to isolate or identify polynudeotides encoding mature protease enzyme described herein from Cellulomonas 69B4, or a segment thereof having proteolytic activity. In some embodiments, portions of the DNA provided in SEQ ID NO:1 find use in obtaining homologous fragments of DNA from other species, and particularly from Micrococcineae spp.
- the present invention further provides at least one probe comprising a polynucleotide substantially identical to a fragment of SEQ ID NOS:1 , 2, 3 or 4, wherein the probe is used to detect a nucleic acid sequence coding for an enzyme having proteolytic activity, and wherein the nucleic acid sequence is obtained from a bacterial source.
- the bacterial source is a Cellulomonas spp.
- the bacterial source is Cellulomonas strain 69B4.
- the present invention further provides compositions comprising at least one of the proteases provided herein. In some preferred embodiments, the compositions are cleaning compositions.
- the present invention provides cleaning compositions comprising a cleaning effective amount of at least one protease comprising an amino acid sequence having at least 40% sequence identity to SEQ ID NO:8, at least 90% sequence identity to SEQ ID NO:8, and/or having an amino acid sequence of SEQ ID NO:8.
- the cleaning compositions further comprise at least one suitable cleaning adjunct.
- the protease is derived from a Cellulomonas sp. In some preferred embodiments, the Cellulomonas spp.
- Cellulomonas fimi is selected from Cellulomonas fimi, Cellulomonas biazotea, Cellulomonas cellasea, Cellulomonas hominis, Cellulomonas flavigena, Cellulomonas persica, Cellulomonas iranensis, Cellulomonas gelida, Cellulomonas humilata, Cellulomonas turbata, Cellulomonas uda, and Cellulomonas strain 69B4 (DSM 16035).
- the Cellulomonas spp is Cellulomonas. strain 69B4.
- the cleaning composition further comprises at least one additional enzymes or enzyme derivatives selected from the group consisting of protease, amylase, lipase, mannanase and cellulase.
- the present invention also provides isolated naturally occurring proteases comprising an amino acid sequence having at least 45% sequence identity to SEQ ID NO:8, at least 60% sequence identity to SEQ ID NO:8, at least 75% sequence identity to SEQ ID NO:8, at least 90% sequence identity to SEQ ID NO:8, at least 95% sequence identity to SEQ ID NO:8, and/or having the sequence identity of SEQ ID NO:8, the protease being isolated from a Cellulomonas spp..
- the protease is isolated from Cellulomonas strain 69B4 (DSM 16035).
- the present invention provides engineered variants of the serine proteases of the present invention.
- the engineered variants are genetically modified using recombinant DNA technologies, while in other embodiments, the variants are naturally occurring.
- the present invention further encompasses engineered variants of homologous enzymes.
- the engineered variant homologous proteases are genetically modified using recombinant DNA technologies, while in other embodiments, the variant homologous proteases are naturally occurring.
- the present invention also provides serine proteases that immunologically cross- react with the Cellulomonas 69B4 protease (i.e., ASP) of the present invention.
- ASP Cellulomonas 69B4 protease
- the present invention encompass fragments (e.g., epitopes) of the ASP protease that stimulate an immune response in animals (including, but not limited to humans) and/or are recognized by antibodies of any class.
- the present invention further encompasses epitopes on proteases that are cross- reactive with ASP epitopes.
- the ASP epitopes are recognized by antibodies, but do not stimulate an immune response in animals (including, but not limited to humans), while in other embodiments, the ASP epitopes stimulate an immune response in at least one animal species (including, but not limited to humans) and are recognized by antibodies of any class.
- the present invention also provides means and compositions for identifying and assessing cross-reactive epitopes.
- the present invention further provides at least one polynucleotide encoding a signal peptide (i) having at least 70% sequence identity to SEQ ID NO:9, or (ii) being capable of hybridizing to a probe derived from the polypeptide sequence encoding SEQ ID NO:9, under conditions of medium to high stringency, or (iii) being complementary to the polypeptide sequence provided in SEQ ID NO:9.
- the present invention provides at vectors comprising the polynucleotide described above.
- a host cell is provided that is transformed with the vector.
- the present invention also provides methods for producing proteases, comprising: (a) transforming a host cell with an expression vector comprising a polynucleotide having at least 70% sequence identity to SEQ ID NO:4, at least 95% sequence identity to SEQ ID NO:4, and/or having a polynucleotide sequence of SEQ ID NO:4; (b) cultivating the transformed host cell under conditions suitable for the host cell to produce the protease; and (c) recovering the protease.
- the host cell is a Bacillus species (e.g., B. subtilis, B. clausii, or B. licheniformis).
- the host cell is a Streptomyces spp., (e.g., Streptomyces lividans).
- the host cell is a Trichoderma spp., (e.g., Trichoderma reesei).
- the host cell is a Aspergillus spp. (e.g., Aspergillus niger).
- an advantage of the present invention is that a polynucleotide has been isolated which provides the capability of isolating further polynudeotides which encode proteins having serine protease activity, wherein the backbone is substantially identical to that of the Cellulomonas protease of the present invention.
- the present invention provides means to produce host cells that are capable of producing the serine proteases of the present invention in relatively large quantities.
- the present invention provides means to produce protease with various commercial applications where degradation or synthesis of polypeptides are desired, including cleaning compositions, as well as feed components, textile processing, leather finishing, grain processing, meat processing, cleaning, preparation of protein hydrolysates, digestive aids, microbicidal compositions, bacteriostatic composition, fungistatic compositions, personal care products, including oral care, hair care, and/or skin care.
- the present invention further provides enzyme compositions have comparable or improved wash performance, as compared to presently used subtilisin proteases. Other objects and advantages of the present invention are apparent from the present Specification.
- the present invention provides an isolated polypeptide having proteolytic activity, (e.g., a protease) having the amino acid sequence set forth in SEQ ID NO:8.
- the present invention provides isolated polypeptides having approximately 40% to 98% identity with the sequence set forth in SEQ ID NO:8.
- the polypeptides have approximately 50% to 95% identity with the sequence set forth in SEQ ID NO:8.
- the polypeptides have approximately 60% to 90% identity with the sequence set forth in SEQ ID NO:8.
- the polypeptides have approximately 65% to 85% identity with the sequence set forth in SEQ ID NO:8.
- the polypeptides have approximately 90% to 95% identity with the sequence set forth in SEQ ID NO:8.
- the present invention further provides proteases obtained from bacteria of the suborder Micrococcineae.
- the proteases are obtained from members of the family Promicromonosporaceae.
- the proteases are obtained from any member of the genera Xylanimicrobium, Xylanibacterium, Xylanimonas, Myceligenerans, and Promicromonospora.
- the proteases are obtained from members of the family Cellulomonadaceae.
- the proteases are obtained from members of the genera Cellulomonas and Oerskovia. In some further preferred embodiments, the proteases are derived from Cellulomonas spp. In some embodiments, the Cellulomonas spp.
- Cellulomonas fimi is selected from Cellulomonas fimi, Cellulomonas biazotea, Cellulomonas cellasea, Cellulomonas hominis, Cellulomonas flavigena, Cellulomonas persica, Cellulomonas iranensis, Cellulomonas gelida, Cellulomonas humilata, Cellulomonas turbata, Cellulomonas uda, Cellulomonas fermentans, Cellulomonas xylanilytica, Cellulomonas humilata and Cellulomonas strain 69B4 (DSM 16035).
- the proteases are derived from Oerskovia spp.
- the Oerskovia spp. is selected from Oerskovia réellensis, Oerskovia paurometabola, Oerskovia enterophila, Oerskovia turbata and Oerskovia turbata strain DSM 20577.
- the proteases have apparent molecular weights of about
- proteases comprise an amino acid sequence comprising at least 40% amino acid sequence identity to SEQ ID NO:8. In some embodiments, the proteases have at least 50% amino acid sequence identity to SEQ ID NO:8. In some embodiments, the proteases have at least 60% amino acid sequence identity to SEQ ID NO:8. In some embodiments, the proteases have at least 70% amino acid sequence identity to SEQ ID NO:8. In some embodiments, the proteases have at least 80% amino acid sequence identity to SEQ ID NO:8.
- the proteases have at least 90% amino acid sequence identity to SEQ ID NO:8. In some embodiments, the proteases have at least 95% amino acid sequence identity to SEQ ID NO:8.
- the present invention also provides expression vectors comprising any of the polynudeotides provided above.
- the present invention further provides host cells transformed with the expression vectors of the present invention, such that at least one protease is expressed by the host cells.
- the host cells are bacteria, while in other embodiments, the host cells are fungi.
- the bacterial host cells are selected from the group consisting of the genera Bacillus and Streptomyces.
- the fungal host cells are members of the genus Trichoderma, while in other alternative preferred embodiments, the fungal host cells are members of the genus Aspergillus.
- the present invention also provides isolated polynudeotides comprising a nucleotide sequence (i) having at least 70% identity to SEQ ID NOS:3 or 4, or (ii) being capable of hybridizing to a probe derived from the nucleotide sequence disclosed in SEQ ID NOS: 3 or 4, under conditions of medium to high stringency, or (iii) being complementary to the nucleotide sequence disclosed in SEQ ID NOS:3 or 4.
- the present invention provides vectors comprising such polynucleotide.
- the present invention provides host cells transformed with such vector.
- the present invention further provides methods for producing at least one enzyme having protease activity, comprising: the steps of transforming a host cell with an expression vector comprising a polynucleotide comprising at least 70% sequence identity to SEQ ID NO:4, cultivating the transformed host cell under conditions suitable for the host cell to produce the protease; and recovering the protease.
- the host cell is a Streptomyces spp, while in other embodiments, the host cell is a Bacillus spp,, a Trichoderma spp., and/or a Aspergillus spp. In some embodiments, the Streptomyces spp.
- the present invention also provides fragments (i.e., portions) of the DNA encoding the proteases provided herein; These fragments find use in obtaining partial length DNA fragments capable of being used to isolate or identify polynudeotides encoding mature protease enzyme described herein from Cellulomonas 69B4, or a segment thereof having proteolytic activity. In some embodiments, portions of the DNA provided in SEQ ID NO:1 find use in obtaining homologous fragments of DNA from other species, and particularly from Micrococcineae spp.
- the present invention further provides at least one probe comprising a polynucleotide substantially identical to a fragment of SEQ ID NOS:1 , 2, 3 or 4, wherein the probe is used to detect a nucleic acid sequence coding for an enzyme having proteolytic activity, and wherein the nucleic acid sequence is obtained from a bacterial source.
- the bacterial source is a Cellulomonas spp.
- the bacterial source is Cellulomonas strain 69B4.
- the present invention further provides compositions comprising at least one of the proteases provided herein. In some preferred embodiments, the compositions are cleaning compositions.
- the present invention provides cleaning compositions comprising a cleaning effective amount of at least one protease comprising an amino acid sequence having at least 40% sequence identity to SEQ ID NO:8, at least 90% sequence identity to SEQ ID NO:8, and/or having an amino acid sequence of SEQ ID NO:8.
- the cleaning compositions further comprise at least one suitable cleaning adjunct.
- the protease is derived from a Cellulomonas sp. In some preferred embodiments, the Cellulomonas spp.
- Cellulomonas fimi is selected from Cellulomonas fimi, Cellulomonas biazotea, Cellulomonas cellasea, Cellulomonas hominis, Cellulomonas flavigena, Cellulomonas persica, Cellulomonas iranensis, Cellulomonas gelida, Cellulomonas humilata, Cellulomonas turbata, Cellulomonas uda, and Cellulomonas strain 69B4 (DSM 16035).
- the Cellulomonas spp is Cellulomonas. strain 69B4.
- the cleaning composition further comprises at least one additional enzymes or enzyme derivatives selected from the group consisting of protease, amylase, lipase, mannanase and cellulase.
- the present invention also provides isolated naturally occurring proteases comprising an amino acid sequence having at least 45% sequence identity to SEQ ID NO:8, at least 60% sequence identity to SEQ ID NO:8, at least 75% sequence identity to SEQ ID NO:8, at least 90% sequence identity to SEQ ID NO:8, at least 95% sequence identity to SEQ ID NO:8, and/or having the sequence identity of SEQ ID NO:8, the protease being isolated from a Cellulomonas spp..
- the protease is isolated from Cellulomonas strain 69B4 (DSM 16035).
- the present invention provides engineered variants of the serine proteases of the present invention.
- the engineered variants are genetically modified using recombinant DNA technologies, while in other embodiments, the variants are naturally occurring.
- the present invention further encompasses engineered variants of homologous enzymes.
- the engineered variant homologous proteases are genetically modified using recombinant DNA technologies, while in other embodiments, the variant homologous proteases are naturally occurring.
- the present invention also provides serine proteases that immunologically cross- react with the ASP protease of the present invention.
- the present invention encompass fragments (e.g., epitopes) of the ASP protease that stimulate an immune response in animals (including, but not limited to humans) and/or are recognized by antibodies of any class.
- the present invention further encompasses epitopes on proteases that are cross-reactive with ASP epitopes.
- the ASP epitopes are recognized by antibodies, but do not stimulate an immune response in animals (including, but not limited to humans), while in other embodiments, the ASP epitopes stimulate an immune response in at least one animal species (including, but not limited to humans) and are recognized by antibodies of any class.
- the present invention also provides means and compositions for identifying and assessing cross- reactive epitopes.
- the present invention further provides at least one polynucleotide encoding a signal peptide (i) having at least 70% sequence identity to SEQ ID NO:9, or (ii) being capable of
- the present invention provides at vectors comprising the polynucleotide described above.
- a host cell is provided that is transformed with the vector.
- the present invention also provides methods for producing proteases, comprising: (a) transforming a host cell with an expression vector comprising a polynucleotide having at least 70% sequence identity to SEQ ID NO:4, at least 95% sequence identity to SEQ ID NO:4, and/or having a polynucleotide sequence of SEQ ID NO:4; (b) cultivating the transformed host cell under conditions suitable for the host cell to produce the protease; ands (c) recovering the protease.
- the host cell is a Bacillus species (e.g., B. subtilis, B. clausii, or B. licheniformis).
- the host cell is a Streptomyces spp., (e.g., Streptomyces lividans).
- the host cell is a Trichoderma spp., (e.g., Trichoderma reesei).
- the host cell is a Aspergillus spp., (e.g., Aspergillus niger).
- the present invention provides means to produce host cells5 that are capable of producing the serine proteases of the present invention in relatively large quantities.
- the present invention provides means to produce protease with various commercial applications where degradation or synthesis of polypeptides are desired, including cleaning compositions, as well as feed components, textile processing, leather finishing, grain processing, meat processing, cleaning,o preparation of protein hydrolysates, digestive aids, microbicidal compositions, bacteriostatic composition, fungistatic compositions, personal care products, including oral care, hair care,' and/or skin care.
- the present invention further provides enzyme compositions have comparable or improved wash performance, as compared to presently used subtilisin proteases. Other objects and advantages of the present invention are apparent from the present Specification.
- FIGURES Figure 1 provides an unrooted phylogenetic tree illustrating the relationship of novel strain 69B4 to members of the family Cellulomonadaceae and other related genera of the suborder Micrococcineae.
- Figure 2 provides a phylogenetic tree for ASP protease.
- Figure 3 provides a MALDI TOF spectrum of a protease derived from Cellulomonas strain 69B4
- Figure 4 shows the sequence of N-terminal most tryptic peptide from C. flavigena
- Figure 5 provides the plasmid map of the pSEGCT vector.
- Figure 6 provides the plasmid map of the pSEGCT69B4 vector.
- Figure 7 provides the plasmid map of the pSEA469BCT vector.
- Figure 8 provides the plasmid map of the pHPLT-Asp-C1-1 vector.
- Figure 9 provides the plasmid map of the pHPLT-Asp-C1-2 vector.
- Figure 10 provides the plasmid map of the pHPLT-Asp-C2-1 vector.
- Figure 11 provides the plasmid map of the pHPLT-Asp-C2-2 vector.
- Figure 12 provides the plasmid map of the pHPLT-ASP-lll vector.
- Figure 13 provides the plasmid map of the pHPLT-ASP-IV vector.
- Figure 14 provides the plasmid map of the pHPLT-ASP-VII vector.
- Figure 15 provides the plasmid map of the pXX-Kpnl vector.
- Figure 16 provides the plasmid map of the p2JM103-DNNP1 vector.
- Figure 17 provides the plasmid map of the pHPLT vector.
- Figure 18 provides the map and MXL-prom sequences for the opened pHPLT-ASP-
- Figure 19 provides the plasmid map of the pENMx3 vector.
- Figure 20 provides the plasmid map of the plCatH vector.
- Figure 21 provides the plasmid map of the pTREX4 vector.
- Figure 22 provides the plasmid map of the pSLGAMpR2 vector.
- Figure 23 provides the plasmid map of the pRAXdes2-ASP vector.
- Figure 28 provides the plasmid map of the pAPDI vector.
- Figure 25 provides graphs showing ASP autolysis.
- Panel A provides a graph showing the ASP autolysis peptides observed in a buffer without LAS.
- Panel B provides a graph showing the ASP autolysis peptides observed in a buffer with 0.1% LAS.
- Figure 26 compares the cleaning activity (absorbance at 405 nm) dose (ppm) response curves of certain serine proteases (69B4 [-x-]; PURAFECT® [ - ⁇ - ]; RELASETM [- A-]; and OPTIMASETM [- ⁇ -] in liquid TIDE® detergent under North American wash conditions.
- Figure 27 provides a graph that compares the cleaning activity (absorbance at 405 nm) dose (ppm) response curves of certain serine proteases (69B4 [-x-]; PURAFECT® [- ⁇ - ]; RELASETM [-A-]; and OPTIMASETM [- ⁇ -] in Detergent Composition III powder detergent (0.66 g/l) North American concentration/detergent formulation under Japanese wash conditions.
- Figure 28 provides a graph that compares the cleaning activity (absorbance at 405 nm) dose (ppm) response curves of certain serine proteases (69B4 [-x-]; PURAFECT® [- ⁇ - ]; RELASETM [-A-]; and OPTIMASETM [- ⁇ -] in ARIEL® REGULAR detergent powder under European wash conditions.
- Figure 29 provides a graph that compares the cleaning activity (absorbance at 405 nm) dose (ppm) response curves of certain serine protease (69B4 [-x-]; PURAFECT® [- ⁇ - ]; RELASETM [-A-]; and OPTIMASETM [- ⁇ -] in PURE CLEAN detergent powder under Japanese conditions.
- Figure 30 provides a graph that compares the cleaning activity (absorbance at 405 nm) dose (ppm) response curves of certain serine proteases (69B4 [-x-]; PURAFECT® [- ⁇ - ]; RELASETM [-A-]; and OPTIMASETM [- ⁇ -] in Detergent Composition III powder (1.00 g/l) under North American conditions.
- Figure 31 provides a graph that shows comparative oxidative inactivation of various serine proteases (100 ppm) as a measure of per cent enzyme activity over time (minutes) (69B4 [-X-]; BPN' variant 1 [- ⁇ - ]; PURAFECT® [-A-]; and GG36-variant 1 [- ⁇ -]) with 0.1 M H 2 O 2 at pH 9.45, 25°C.
- Figure 32 provides a graph that shows comparative chelator inactivation of various serine proteases (100 ppm) as a measure of per cent enzyme activity over time (minutes) (69B4 [-x-3; BPN'-variant 1 [- ⁇ - ]; PURAFECT® [-A-]; and GG36-variant 1 [- ⁇ -] with 10mM EDTA at pH 8.20, 45 ° C.
- Figure 33 provides a graph that shows comparative thermal inactivation of various serine proteases (100 ppm) as a measure of percent enzyme activity over time (minutes) (69B4 [-X-]; BPN'-variant [- ⁇ - ]; PURAFECT® [-A-]; and GG36-variant 1 [- ⁇ -] with 50 mM Tris at pH 8.0, 45°C.
- Figure 34 provides a graph that shows comparative thermal inactivation of certain serine proteases (69B4 [-x-]; BPN'-variant [- ⁇ - ]; PURAFECT® [-A-]; and GG36-variant-1 [- ⁇ -] at pH 8.60, over a temperature gradient of 57 ° C to 62°C.
- Figure 35 provides a graph that shows enzyme activity (hydrolysis of di-methyl casein measured by absorbance at 405 nm) of certain serine proteases (2.5 ppm) (69B4 [- ⁇ - ]; BPN'-variant [- ⁇ - PURAFECT® [-A-]; and GG36-variant 1[ -• -] at pH 's ranging from 5 to 12 at 37°C.
- Figure 36 provides a bar graph that shows enzyme stability as indicated by %o remaining activity (hydrolysis of di-methyl casein measured by absorbance at 405 nm) of certain serine proteases (2.5 ppm) (69B4, BPN'- variant; PURAFECT® and GG36-variant 1 at pHs ranging from 3 (
- Figure 37 provides a graph that shows enzyme stability as indicated by % remainings activity of a BPN'-variant at pH ranges from 3 (- ⁇ -), 4 (-- ⁇ --), 5 ( - A ⁇ ) to 6 (-X-) at 25°, 35 ° , and 45°O, respectively
- Figure 38 provides a graph that shows enzyme stability as indicated by % remaining activity of PURAFECT® TM protease at pH ranges from 3 (- ⁇ - ), 4 (- ⁇ --), 5 (--A- ) to 6 (--- X-) at 25°, 35°, and 45°O, respectivelyo
- Figure 39 provides a graph that shows enzyme stability as indicated by % remaining activity of 69B4 protease at pH ranges from 3 (- ⁇ - ), 4 (-- ⁇ --), 5 ( ⁇ A ⁇ ) to 6 (--X-) at 25 °, 35° and 45°C, respectively
- the present invention provides novel serine proteases, novel genetic material encoding these enzymes, and proteolytic proteins obtained from Micrococcineae spp., including but not limited to Cellulomonas spp. and variant proteins developed therefrom.
- the present invention provides protease compositions obtained from a Cellulomonas spp, DNA encoding the protease, vectors comprising the DNA encoding theo protease, host cells transformed with the vector DNA, and an enzyme produced by the host cells.
- the present invention also provides cleaning compositions (e.g., detergent compositions), animal feed compositions, and textile and leather processing compositions comprising protease(s) obtained from a Micrococcineae spp., including but not limited to Cellulomonas spp.
- cleaning compositions e.g., detergent compositions
- animal feed compositions e.g., animal feed compositions
- textile and leather processing compositions comprising protease(s) obtained from a Micrococcineae spp., including but not limited to Cellulomonas spp.
- mutant proteases derived from the wild-type proteases described herein. These mutant proteases also find use in numerous applications! Gram-positive alkalophilic bacteria have been isolated from in and around alkaline soda lakes (See e.g., U.S. Pat. No. 5,401 ,657, herein incorporated by reference).
- alkalophilic were analyzed according to the principles of numerical taxonomy with respect to each other and also a collection of known bacteria, and taxonomically characterized. Six natural clusters or phenons of alkalophilic bacteria were generated. Amongst the strains isolated was a strain identified as 69B4.
- Cellulomonas spp. are Gram-positive bacteria classified as members of the family Cellulomonadaceae, Suborder Micrococcineae, Order Actinomycetales, Class Actinobacteria. Cellulomonas grows as slender, often irregular rods that may occasionally show branching, but no mycelium is formed. In addition, there is no aerial growth and no spores are formed.
- Streptomyces are only distantly related at a genetic level. The large genetic (genomic) distinction between Cellulomonas and Streptomyces is reflected in a great difference in phenotypic properties. While serine proteases in Streptomyces have been previously examined, there apparently have been no reports of any serine proteases (approx. MW 18,000 to 20,000) secreted by Cellulomonas spp. In addition, there apparently have been no previous reports of Cellulomonas proteases being used in the cleaning and/or feed industry. Streptomyces are Gram-positive bacteria classified as members of the Family Streptomycetaceae, Suborder Streptomycineae, Order Actinomycetales, class
- Streptomyces grows as an extensively branching primary or substrate mycelium and an abundant aerial mycelium that at maturity bear characteristic spores.
- Streptogrisins are serine proteases secreted in large amounts from a wide variety of Streptomyces species. The amino acid sequences of Streptomyces proteases have been determined from at least 9 different species of Streptomyces including Streptomyces griseus Streptogrisin C (accession no. P52320); alkaline proteinase (EC 3.4.21.-) from Streptomyces sp. (accession no. PC2053); alkaline serine proteinase I from Streptomyces sp. (accession no.
- a purified native alkaline protease having an apparent molecular weight of 19,000 daltons and isolated from Streptomyces griseus var. alcalophilus protease and cleaning compositions comprised thereof have been described (See e.g., U.S. Patent No. 5,646,028, incorporated herein by reference).
- the present invention provides protease enzymes produced by these organisms. Importantly, these enzymes have good stability and proteolytic activity. These enzymes find use in various applications, including but not limited to cleaning compositions, animal feed, textile processing and etc.
- the present invention also provides means to produce these enzymes.
- the proteases of the present invention are in pure or relatively pure form.
- the present invention also provides nucleotide sequences which are suitable to produce the proteases of the present invention in recombinant organisms.
- recombinant production provides means to produce the proteases in quantities that are commercially viable.
- the practice of the present invention involves conventional techniques commonly used in molecular biology, microbiology, and recombinant DNA, which are within the skill of the art. Such techniques are known to those of skill in the art and are described in numerous texts and reference works (See e.g., Sambrook et al., "Molecular Cloning: A Laboratory Manual", Second Edition (Cold Spring Harbor), [1989]); and Ausubel etal, "Current Protocols in Molecular Biology” [1987]).
- proteolytic activity refers to a protein or peptide exhibiting the ability to hydrolyze peptides or substrates having peptide linkages.
- Many well known procedures exist for measuring proteolytic activity Kalisz, "Microbial Proteinases,” In: Fiechter (ed.), Advances in Biochemical Engineering/Biotechnology, [1988]).
- proteolytic activity may be ascertained by comparative assays which analyze the respective protease's ability to hydrolyze a commercial substrate.
- Exemplary substrates useful in the such analysis of protease or protelytic activity include, but are not limited to di-methyl casein (Sigma C-9801), bovine collagen (Sigma C-9879), bovine elastin (Sigma E-1625), and bovine keratin (ICN Biomedical 902111). Colorimetric assays utilizing these substrates are well known in the art (See e.g., WO 99/34011 ; and U.S. Pat. No. 6,376,450, both of which are incorporated herein by reference. The pNA assay (See e.g., Del Mar et al., Anal.
- Biochem., 99:316-320 [1979]) also finds use in determining the active enzyme concentration for fractions collected during gradient elution.
- This assay measures the rate at which p-nitroaniline is released as the enzyme hydrolyzes the soluble synthetic substrate, succinyl-alanine-alanine-proline-phenylalanine-p-nitroanilide (sAAPF-pNA).
- sAAPF-pNA succinyl-alanine-alanine-proline-phenylalanine-p-nitroanilide
- the rate of production of yellow color from the hydrolysis reaction is measured at 410 nm on a spectrophotometer and is proportional to the active enzyme concentration.
- absorbance measurements at 280 nm can be used to determine the total protein concentration.
- the active enzyme/total-protein ratio gives the enzyme purity.
- ASP protease As used herein, the terms "ASP protease,” “Asp protease,” and “Asp,” refer to the serine proteases described herein.
- the Asp protease is the protease designed herein as 69B4 protease obtained from Cellulomonas strain 69B4.
- 69B4 protease refers to a naturally occurring mature protease derived from Cellulomonas strain 69B4 (DSM 16035) having substantially identical amino acid sequences as provided in SEQ ID NO:8.
- the present invention provides portions of the ASP protease.
- Cellulomonas protease homologues refers to naturally occurring proteases having substantially identical amino acid sequences to the mature protease derived from Cellulomonas strain 69B4 or polynucleotide sequences which encode for such naturally occurring proteases, and which proteases retain the functional characteristics of a serine protease encoded by such nucleic acids.
- protease homologues are referred to as “cellulomonadins.”
- proteadins the terms “protease variant,” “ASP variant,” “ASP protease variant,” and “69B protease variant” are used in reference to proteases that are similar to the wild- type ASP, particularly in their function, but have mutations in their amino acid sequence that make them different in sequence from the wild-type protease.
- Cellulomonas ssp refers to all of the species within the genus “Cellulomonas,” which are Gram-positive bacteria classified as members of the Family Cellulomonadaceae, Suborder Micrococcineae, Order Actinomycetales, Class Actinobacteria. It is recognized that the genus Cellulomonas continues to undergo taxonomical reorganization.
- the genus include species that have been reclassified As used herein, "Streptomyces ssp.” refers to all of the species within the genus "Streptomyces,” which are Gram-positive bacteria classified as members of the Family Streptomycetaceae, Suborder Streptomycineae, Order Actinomycetales, class Actinobacteria. It is recognized that the genus Streptomyces continues to undergo taxonomical reorganization. Thus, it is intended that the genus include species that have been reclassified As used herein, "the genus Bacillus” includes all species within the genus "Bacillus,” as known to those of skill in the art, including but not limited to B.
- subtilis subtilis, B. licheniformis, B. lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B. amyloliquefaciens, B. clausii, B. halodurans, B. megatehum, B. coagulans, B. circulans, B. lautus, and B. thuringiensis.
- B. subtilis subtilis, B. licheniformis, B. lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B. amyloliquefaciens, B. clausii, B. halodurans, B. megatehum, B. coagulans, B. circulans, B. lautus, and B. thuringiensis.
- B. Bacillus continues to undergo taxonomical reorganization.
- the genus include species that have been reclassified, including but not limited to such organisms as B.
- stearothermophilus which is now named "Geobacillus stearothermophilus.”
- the production of resistant endospores in the presence of oxygen is considered the defining feature of the genus Bacillus, although this characteristic also applies to the recently named Alicyclobacillus, Amphibacillus, Aneurinibacillus, Anoxybacillus, Brevibacill ⁇ s, Filobacillus, Gracilibacillus, Halobacillus, Paenibacillus, Salibacillus, Thermobacillus, Ureibacillus, and Virgibacillus.
- polynucleotide and “nucleic acid”, used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. These terms include, but are not limited to, a single-, double- or triple-stranded DNA,-genomic DNA, cDNA, RNA, DNA-RNA hybrid, or a polymer comprising purine and pyrimidine bases, or other natural, chemically, biochemically modified, non- natural or derivatized nucleotide bases.
- polynudeotides genes, gene fragments, chromosomal fragments, ESTs, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynudeotides, branched polynudeotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- polynudeotides comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracil, other sugars and linking groups such as fluorohbose and thioate, and nucleotide branches.
- the sequence of . nucleotides is interrupted by non- nucleotide components.
- DNA construct and “transforming DNA” are used interchangeably to refer to DNA used to introduce sequences into a host cell or organism. The DNA may be generated in vitro by PCR or any other suitable technique(s) known to those in the art.
- the DNA construct comprises a sequence of interest (e.g., as an incoming sequence).
- the sequence is operably linked to additional elements such as control elements (e.g., promoters, etc.).
- the DNA construct may further comprise a selectable marker. It may further comprise an incoming sequence flanked by homology boxes.
- the transforming DNA comprises other non-homologous sequences, added to the ends (e.g., stuffer sequences or flanks).
- the ends of the incoming sequence are closed such that the transforming DNA forms a closed circle.
- the transforming sequences may be wild-type, mutant or modified.
- the DNA construct comprises sequences homologous to the host cell chromosome. In other embodiments, the DNA construct comprises non-homologous sequences.
- the DNA construct may be used to: 1) insert heterologous sequences into a desired target sequence of a host cell, and/or 2) mutagenize a region of the host cell chromosome (i.e., replace an endogenous sequence with a heterologous sequence), 3) delete target genes; and/or introduce a replicating plasmid into the host.
- expression cassette and “expression vector” refer to nucleic acid constructs generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
- the recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment.
- the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
- expression vectors have the ability to incorporate and express heterologous DNA fragments in a host cell. Many prokaryotic and eukaryotic expression vectors are commercially available. Selection of appropriate expression vectors is within the knowledge of those of skill in the art.
- expression cassette is used interchangeably herein with "DNA construct,” and their grammatical equivalents.
- vector refers to a polynucleotide construct designed to introduce nucleic acids into one or more cell types.
- Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, cassettes and the like.
- the polynucleotide construct comprises a DNA sequence encoding the protease (e.g., precursor or mature protease) that is operably linked to a suitable prosequence (e.g., secretory, etc.) capable of effecting the expression of the DNA in a suitable host.
- protease e.g., precursor or mature protease
- suitable prosequence e.g., secretory, etc.
- plasmid refers to a circular double-stranded (ds) DNA construct used as a cloning vector, and which forms an extrachromosomal self-replicating genetic element in some eukaryotes or prokaryotes, or integrates into the host chromosome.
- introduction refers to any method suitable for transferring the nucleic acid sequence into the cell.
- Such methods for introduction include but are not limited to protoplast fusion, transfection, transformation, conjugation, and transduction (See e.g., Ferrari et al., "Genetics,” in Hardwood etal, (eds.), Bacillus. Plenum Publishing Corp., pages 57-72, [1989]).
- the terms “transformed” and “stably transformed” refers to a cell that has a non-native (heterologous) polynucleotide sequence integrated into its genome or as an episomal plasmid that is maintained for at least two generations.
- selectable marker-encoding nucleotide sequence refers to a nucleotide sequence which is capable of expression in the host cells and where expression of the selectable marker confers to cells containing the expressed gene the ability to grow in the presence of a corresponding selective agent or lack of an essential nutrient.
- selectable marker and selective marker refer to a nucleic acid (e.g., a gene) capable of expression in host cell which allows for ease of selection of those hosts containing the vector. Examples of such selectable markers include but are not limited to antimicrobials.
- selectable marker refers to genes that provide an indication that a host cell has taken up an incoming DNA of interest or some other reaction has occurred.
- selectable markers are genes that confer antimicrobial resistance or a metabolic advantage on the host cell to allow cells containing the exogenous DNA to be distinguished from cells that have not received any exogenous sequence during the transformation.
- a "residing selectable marker” is one that is located on the chromosome of the microorganism to be transformed.
- a residing selectable marker encodes a gene that is different from the selectable marker on the transforming DNA construct. Selective markers are well known to those of skill in the art.
- the marker is an antimicrobial resistant marker (e.g., amp R ; phleo R ; spec R ; kan R ; ery R ; tet R ; cmp R ; and neo R ; See e.g., Guerot-Fleury, Gene, 167:335-337 [1995]; Palmeros et al., Gene 247:255-264 [2000]; and Trieu-Cuot et al., Gene, 23:331 -341 [1983]).
- Other markers useful in accordance with the invention include, but are not limited to auxotrophic markers, such as tryptophan; and detection markers, such as ⁇ - galactosidase.
- promoter refers to a nucleic acid sequence that functions to direct transcription of a downstream gene.
- the promoter is appropriate to the host cell in which the target gene is being expressed.
- the promoter, together with other transcriptional and translational regulatory nucleic acid sequences (also termed “control sequences") is necessary to express a given gene.
- control sequences also termed "control sequences”
- transcriptional and translational regulatory sequences include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.
- a nucleic acid is "operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
- DNA encoding a secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites.
- the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- the term "gene” refers to a polynucleotide (e.g., a DNA segment), that encodes a polypeptide and includes regions preceding and following the coding regions as well as intervening sequences (introns) between individual coding segments (exons).
- homologous genes refers to a pair of genes from different, but usually related species, which correspond to each other and which are identical or very similar to each other.
- orthologous genes genes that are separated by speciation (i.e., the development of new species) (e.g., orthologous genes), as well as genes that have been separated by genetic duplication (e.g., paralogous genes).
- ortholog and “orthologous genes” refer to genes in different species that have evolved from a common ancestral gene (i.e., a homologous gene) by speciation. Typically, orthologs retain the same function during the course of evolution. Identification of orthologs finds use in the reliable prediction of gene function in newly sequenced genomes.
- paralog and “paralogous genes” refer to genes that are related by duplication within a genome.
- paralogous genes include, but are not limited to genes encoding trypsin, chymotrypsin, elastase, and thrombin, which are all serine proteinases and occur together within the same species.
- homology refers to sequence similarity or identity, with identity being preferred. This homology is determined using standard techniques known in the art (See e.g., Smith and Waterman, Adv. Appl. Math., 2:482 [1981]; Needleman and Wunsch, J. Mol. Biol., 48:443 [1970]; Pearson and Lipman, Proc. Natl.
- an "analogous sequence” is one wherein the function of the gene is essentially the same as the gene based on the Cellulomonas strain 69B4 protease.
- analogous genes include at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% sequence identity with the sequence of the Cellulomonas strain 69B4 protease.
- analogous sequences have an alignment of between 70 to 100% of the genes found in the Cellulomonas strain 69B4 protease region and/or have at least between 5 - 10 genes found in the region aligned with the genes in the Cellulomonas strain 69B4 chromosome. In additional embodiments more than one of the above properties applies to the sequence.
- Analogous sequences are determined by known methods of sequence alignment.
- a commonly used alignment method is BLAST, although as indicated above and below, there are other methods that also find use in aligning sequences.
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (Feng and Doolittle, J. Mol. Evol., 35:351-360 [1987]). The method is similar to that described by Higgins and Sharp (Higgins and Sharp, CABiOS 5:151-153 [1989]).
- Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps.
- Another example of a useful algorithm is the BLAST algorithm, described by Altschul etal., (Altschul er a/., J. Mol. Biol., 215:403-410, [1990]; and Karlin era/., Proc. Natl. Acad. Sci. USA 90:5873-5787 [1993]).
- a particularly useful BLAST program is the WU-BLAST-2 program (See, Altschul etal., Meth. Enzymol., 266:460-480 [1996]). WU-BLAST-2 uses several search parameters, most of which are set to the default values.
- the HSP S and HSP S2 parameters are dynamic values and are established by the program itself depending upon the composition of the particular sequence and composition of the particular database against which the sequence of interest is being searched. However, the values may be adjusted to increase sensitivity.
- a % amino acid sequence identity value is determined by the number of matching identical residues divided by the total number of residues of the "longer" sequence in the aligned region.
- the "longer" sequence is the one having the most actual residues in the aligned region (gaps introduced by WU-Blast-2 to maximize the alignment score are ignored).
- percent (%) nucleic acid sequence identity is defined as the percentage of nucleotide residues in a candidate sequence that are identical with the nucleotide residues of the starting sequence (i.e., the sequence of interest).
- a preferred method utilizes the BLASTN module of WU-BLAST-2 set to the default parameters, with overlap span and overlap fraction set to 1 and 0.125, respectively.
- hybridization refers to the process by which a strand of nucleic acid joins with a complementary strand through base pairing, as known in the art.
- a nucleic acid sequence is considered to be "selectively hybridizable" to a reference nucleic acid sequence if the two sequences specifically hybridize to one another under moderate to high stringency hybridization and wash conditions.
- Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex or probe.
- Tm melting temperature
- maximum stringency typically occurs at about Tm-5°C (5° below the Tm of the probe); “high stringency” at about 5-10°C below the Tm; “intermediate stringency” at about 10-20°C below the Tm of the probe; and “low stringency” at about 20-25°C below the Tm.
- maximum stringency conditions may be used to identify sequences having strict identity or near-strict identity with the hybridization probe; while an intermediate or low stringency hybridization can be used to identify or detect polynucleotide sequence homologs.
- Moderate and high stringency hybridization conditions are well known in the art.
- An example of high stringency conditions includes hybridization at about 42°C in 50% formamide, 5X SSC, 5X Denhardt's solution, 0.5% SDS and 100 ⁇ g/ml denatured carrier DNA followed by washing two times in 2X SSC and 0.5% SDS at room temperature and two additional times in 0.1 X SSC and 0.5% SDS at 42°C.
- moderate stringent conditions include an overnight incubation at 37°C in a solution comprising 20% formamide, 5 x SSC (150mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5 x Denhardt's solution, 10% dextran sulfate and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in 1x SSC at about 37 - 50°C.
- Those of skill in the art know how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors such as probe length and the like.
- recombinant includes reference to a cell or vector, that has been modified by the introduction of a heterologous nucleic acid sequence or that the cell is derived from a cell so modified.
- recombinant cells express genes that are not found in identical form within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all as a result of deliberate human intervention.
- “Recombination,” “recombining,” and generating a “recombined” nucleic acid are generally the assembly of two or more nucleic acid fragments wherein the assembly gives rise to a chimeric gene.
- mutant DNA sequences are generated with site saturation mutagenesis in at least one codon. In another preferred embodiment, site saturation mutagenesis is performed for two or more codons. In a further embodiment, mutant DNA sequences have more than 50%, more than 55%, more than 60%, more than 65%, more than 70%, more than 75%, more than 80%, more than 85%, more than 90%, more than 95%, or more than 98% homology with the wild-type sequence. In alternative embodiments, mutant DNA is generated in vivo using any known mutagenic procedure such as, for example, radiation, nitrosoguanidine and the like. The desired DNA sequence is then isolated and used in the methods provided herein.
- target sequence refers to a DNA sequence in the host cell that encodes the sequence where it is desired for the incoming sequence to be inserted into the host cell genome.
- the target sequence encodes a functional wild-type gene or operon, while in other embodiments the target sequence encodes a functional mutant gene or operon, or a non-functional gene or operon.
- a “flanking sequence” refers to any sequence that is either upstream or downstream of the sequence being discussed (e.g., for genes A-B-C, gene B is flanked by the A and C gene sequences).
- the incoming sequence is flanked by a homology box on each side.
- the incoming sequence and the homology boxes comprise a unit that is flanked by stuffer sequence on each side.
- a flanking sequence is present on only a single side (either 3' or 5'), but in preferred embodiments, it is on each side of the sequence being flanked.
- a flanking sequence is present on only a single side (either 3' or 5'), while in preferred embodiments, it is present on each side of the sequence being flanked.
- the term "stuffer sequence” refers to any extra DNA that flanks homology boxes (typically vector sequences). However, the term encompasses any non- homologous DNA sequence.
- a stuffer sequence provides a noncritical target for a cell to initiate DNA uptake.
- amplification and “gene amplification” refer to a process by which specific DNA sequences are disproportionately replicated such that the amplified gene becomes present in a higher copy number than was initially present in the genome.
- selection of cells by growth in the presence of a drug results in the amplification of either the endogenous gene encoding the gene product required for growth in the presence of the drug or by amplification of exogenous (i.e., input) sequences encoding this gene product, or both.
- Amplification is a special case of nucleic acid replication involving template specificity. It is to be contrasted with non-specific template replication (i.e., replication that is template-dependent but not dependent on a specific template). Template specificity is here distinguished from fidelity of replication (i.e., synthesis of the proper polynucleotide sequence) and nucleotide (ribo- or deoxyribo-) specificity. Template specificity is frequently described in terms of “target” specificity. Target sequences are “targets” in the sense that they are sought to be sorted out from other nucleic acid. Amplification techniques have been designed primarily for this sorting out.
- the term "co-amplification” refers to the introduction into a single cell of an amplifiable marker in conjunction with other gene sequences (i.e., comprising one or more non-selectable genes such as those contained within an expression vector) and the application of appropriate selective pressure such that the cell amplifies both the amplifiable marker and the other, non-selectable gene sequences.
- the amplifiable marker may be physically linked to the other gene sequences or alternatively two separate pieces of DNA, one containing the amplifiable marker and the other containing the non-selectable marker, may be introduced into the same cell.
- amplifiable marker As used herein, the terms "amplifiable marker,” “amplifiable gene,” and “amplification vector” refer to a gene or a vector encoding a gene which permits the amplification of that gene under appropriate growth conditions. "Template specificity" is achieved in most amplification techniques by the choice of enzyme. Amplification enzymes are enzymes that, under conditions they are used, will process only specific sequences of nucleic acid in a heterogeneous mixture of nucleic acid. For example, in the case of Q ⁇ replicase, MDV-1 RNA is the specific template for the replicase (See e.g., Kacian etal., Proc. Natl. Acad. Sci. USA 69:3038 [1972]).
- this amplification enzyme has a stringent specificity for its own promoters (See, Chamberlin et al., Nature 228:227 [1970]).
- T4 DNA ligase the enzyme will not ligate the two oligonucleotides or polynudeotides, where there is a mismatch between the oligonucleotide or polynucleotide substrate and the template at the ligation junction (See, Wu and Wallace, Genomics 4:560 [1989]).
- Tag and Pfu polymerases by virtue of their ability to function at high temperature, are found to display high specificity for the sequences bounded and thus defined by the primers; the high temperature results in thermodynamic conditions that favor primer hybridization with the target sequences and not hybridization with non-target sequences.
- amplifiable nucleic acid refers to nucleic acids which may be amplified by any amplification method. It is contemplated that "amplifiable nucleic acid” will usually comprise “sample template.”
- sample template refers to nucleic acid originating from a sample which is analyzed for the presence of "target” (defined below).
- background template is used in reference to nucleic acid other than sample template which may or may not be present in a sample. Background template is most often inadvertent. It may be the result of carryover, or it may be due to the presence of nucleic acid contaminants sought to be purified away from the sample. For example, nucleic acids from organisms other than those to be detected may be present as background in a test sample.
- the term "primer” refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, which is capable of acting as a point of initiation of synthesis when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced, (i.e., in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH).
- the primer is preferably single stranded for maximum efficiency in amplification, but may alternatively be double stranded. If double stranded, the primer is first treated to separate its strands before being used to prepare extension products.
- the primer is an oligodeoxyribonucleotide.
- the primer must be sufficiently long to prime the synthesis of extension products in the presence of the inducing agent. The exact lengths of the primers will depend on many factors, including temperature, source of primer and the use of the method.
- the term "probe” refers to an oligonucleotide (i.e., a sequence of nucleotides), whether occurring naturally as in a purified restriction digest or produced synthetically, recombinantly or by PCR amplification, which is capable of hybridizing to another oligonucleotide of interest.
- a probe may be single-stranded or double-stranded.
- Probes are useful in the detection, identification and isolation of particular gene sequences. It is contemplated that any probe used in the present invention will be labeled with any "reporter molecule,” so that is detectable in any detection system, including, but not limited to enzyme (e.g., ELISA, as well as enzyme-based histochemical assays), fluorescent, radioactive, and luminescent systems. It is not intended that the present invention be limited to any particular detection system or label.
- the term "target,” when used in reference to the polymerase chain reaction refers to the region of nucleic acid bounded by the primers used for polymerase chain reaction. Thus, the "target” is sought to be sorted out from other nucleic acid sequences.
- a “segment” is defined as a region of nucleic acid within the target sequence.
- PCR polymerase chain reaction
- U.S. Patent Nos. 4,683,1954,683,202, and 4,965,188 refers to the methods of U.S. Patent Nos. 4,683,1954,683,202, and 4,965,188, hereby incorporated by reference, which include methods for increasing the concentration of a segment of a target sequence in a mixture of genomic DNA without cloning or purification.
- This process for amplifying the target sequence consists of introducing a large excess of two oligonucleotide primers to the DNA mixture containing the desired target sequence, followed by a precise sequence of thermal cycling in the presence of a DNA polymerase. The two primers are complementary to their respective strands of the double stranded target sequence.
- the mixture is denatured and the primers then annealed to their complementary sequences within the target molecule.
- the primers are extended with a polymerase so as to form a new pair of complementary strands.
- the steps of denaturation, primer annealing and polymerase extension can be repeated many times (i.e., denaturation, annealing and extension constitute one "cycle”; there can be numerous "cycles") to obtain a high concentration of an amplified segment of the desired target sequence.
- the length of the amplified segment of the desired target sequence is determined by the relative positions of the primers with respect to each other, and therefore, this length is a controllable parameter.
- PCR polymerase chain reaction
- amplification reagents refers to those reagents (deoxyribonucleotide triphosphates, buffer, etc.), needed for amplification except for primers, nucleic acid template and the amplification enzyme.
- amplification reagents along with other reaction components are placed and contained in a reaction vessel (test tube, microwell, etc.).
- PCR it is possible to amplify a single copy of a specific target sequence in genomic DNA to a level detectable by several different methodologies (e.g., hybridization with a labeled probe; incorporation of biotinylated primers followed by avidin-enzyme conjugate detection; incorporation of 32 P-labeled deoxynucleotide triphosphates, such as dCTP or dATP, into the amplified segment).
- any oligonucleotide or polynucleotide sequence can be amplified with the appropriate set of primer molecules.
- the amplified segments created by the PCR process itself are, themselves, efficient templates for subsequent PCR amplifications.
- PCR product refers to the resultant mixture of compounds after two or more cycles of the PCR steps of denaturation, annealing and extension are complete. These terms encompass the case where there has been amplification of one or more segments of one or more target sequences.
- RT-PCR refers to the replication and amplification of RNA sequences. In this method, reverse transcription is coupled to PCR, most often using a one enzyme procedure in which a thermostable polymerase is employed, as described in U.S. Patent No. 5,322,770, herein incorporated by reference.
- RNA template is converted to cDNA due to the reverse transcriptase activity of the polymerase, and then amplified using the polymerizing activity of the polymerase (i.e., as in other PCR methods).
- the terms “restriction endonucleases” and “restriction enzymes” refer to bacterial enzymes, each of which cut double-stranded DNA at or near a specific nucleotide sequence.
- a “restriction site” refers to a nucleotide sequence recognized and cleaved by a given restriction endonuclease and is frequently the site for insertion of DNA fragments.
- restriction sites are engineered into the selective marker and into 5' and 3' ends of the DNA construct.
- chromosomal integration refers to the process whereby an incoming sequence is introduced into the chromosome of a host cell. The homologous regions of the transforming DNA align with homologous regions of the chromosome. Subsequently, the sequence between the homology boxes is replaced by the incoming sequence in a double crossover (i.e., homologous recombination). In some embodiments of the present invention, homologous sections of an inactivating chromosomal segment of a DNA construct align with the flanking homologous regions of the indigenous chromosomal region of the Bacillus chromosome.
- homologous recombination means the exchange of DNA fragments between two DNA molecules or paired chromosomes at the site of identical or nearly identical nucleotide sequences.
- chromosomal integration is homologous recombination.
- homologous sequences as used herein means a nucleic acid or polypeptide sequence having 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 88%, 85%, 80%, 75%, or 70% sequence identity to another nucleic acid or polypeptide sequence when optimally aligned for comparison. In some embodiments, homologous sequences have between 85% and 100% sequence identity, while in other embodiments there is between 90% and 100% sequence identity, and in more preferred embodiments, there is 95% and 100% sequence identity.
- amino acid refers to peptide or protein sequences or portions thereof.
- protein protein
- peptide and “polypeptide” are used interchangeably.
- protein of interest and “polypeptide of interest” refer to a protein/polypeptide that is desired and/or being assessed.
- the protein of interest is expressed intracellularly, while in other embodiments, it is a secreted polypeptide.
- these enzyme include the serine proteases of the present invention.
- the protein of interest is a secreted polypeptide which is fused to a signal peptide (i.e., an amino-terminal extension on a protein to be secreted). Nearly all secreted proteins use an amino- terminal protein extension which plays a crucial role in the targeting to and translocation of precursor proteins across the membrane.
- heterologous protein refers to a protein or polypeptide that does not naturally occur in the host cell.
- heterologous proteins include enzymes such as hydrolases including proteases.
- the gene encoding the proteins are naturally occurring genes, while in other embodiments, mutated and/or synthetic genes are used.
- homologous protein refers to a protein or polypeptide native or naturally occurring in a cell.
- the cell is a Gram-positive cell, while in particularly preferred embodiments, the cell is a Bacillus host cell.
- the homologous protein is a native protein produced by other organisms, including but not limited to E. coli, Streptomyces, Trichoderma, and Aspergillus.
- the invention encompasses host cells producing the homologous protein via recombinant DNA technology.
- an "operon region" comprises a group of contiguous genes that are transcribed as a single transcription unit from a common promoter, and are thereby subject to co-regulation.
- the operon includes a regulator gene.
- operons that are highly expressed as measured by RNA levels, but have an unknown or unnecessary function are used.
- an "antimicrobial region” is a region containing at least one gene that encodes an antimicrobial protein.
- a polynucleotide is said to "encode” an RNA or a polypeptide if, in its native state or when manipulated by methods known to those of skill in the art, it can be transcribed and/or translated to produce the RNA, the polypeptide or a fragment thereof.
- the anti-sense strand of such a nucleic acid is also said to encode the sequences.
- a DNA can be transcribed by an RNA polymerase to produce
- RNA but an RNA can be reverse transcribed by reverse transcriptase to produce a DNA.
- a DNA can encode a RNA and vice versa.
- the term "regulatory . segment” or “regulatory sequence” or “expression control sequence” refers to a polynucleotide sequence of DNA that is operatively linked with a polynucleotide sequence of DNA that encodes the amino acid sequence of a polypeptide chain to effect the expression of the encoded amino acid sequence.
- the regulatory sequence can inhibit, repress, or promote the expression of the operably linked polynucleotide sequnce encoding the amino acid.
- "Host strain” or “host cell” refers to a suitable host for an expression vector comprising DNA according to the present invention.
- An enzyme is "overexpressed” in a host cell if the enzyme is expressed in the cell at a higher level that the level at which it is expressed in a corresponding wild-type cell.
- protein and “polypeptide” are used interchangeability herein.
- the 3-letter code for amino acids as defined in conformity with the IUPAC-IUB Joint Commission on Biochemical Nomenclature (JCBN) is used through out this disclosure. It is also understood that a polypeptide may be coded for by more than one nucleotide sequence due to the degeneracy of the genetic code.
- a “prosequence” is an amino acid sequence between the signal sequence and mature protease that is necessary for the secretion of the protease.
- signal sequence or “signal peptide” refers to any sequence of nucleotides and/or amino acids which may participate in the secretion of the mature or precursor forms of the protein.
- This definition of signal sequence is a functional one, meant to include all those amino acid sequences encoded by the N-terminal portion of the protein gene, which participate in the effectuation of the secretion of protein. They are often, but not universally, bound to the N-terminal portion of a protein or to the N-terminal portion of a precursor protein.
- the signal sequence may be endogenous or exogenous.
- the signal sequence may be that normally associated with the protein (e.g., protease), or may be from a gene encoding another secreted protein.
- One exemplary exogenous signal sequence comprises the first seven amino acid residues of the signal sequence from Bacillus subtilis subtilisin fused to the remainder of the signal sequence of the subtilisin from Bacillus lentus (ATCC 21536).
- hybrid signal sequence refers to signal sequences in which part of sequence is obtained from the expression host fused to the signal sequence of the gene to be expressed. In some embodiments, synthetic sequences are utilized.
- substantially the same signal activity refers to the signal activity, as indicated by substantially the same secretion of the protease into the fermentation medium, for example a fermentation medium protease level being at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% of the secreted protease levels in the fermentation medium as provided by the signal sequence of SEQ ID NOS:5 and/or 9.
- mature form of a protein or peptide refers to the final functional form of the protein or peptide.
- a mature form of the protease of the present invention at least includes the amino acid sequence identical to residue positions 1-189 of SEQ ID NO:8.
- precursor form of a protein or peptide refers to a mature form of the protein having a prosequence operably linked to the amino or carbonyl terminus of the protein.
- the precursor may also have a "signal" sequence operably linked, to the amino terminus of the prosequence.
- the precursor may also have additional polynudeotides that are involved in post-translational activity (e.g., polynudeotides cleaved therefrom to leave the mature form of a protein or peptide).
- “Naturally occurring enzyme” refers to an enzyme having the unmodified amino acid sequence identical to that found in nature. Naturally occurring enzymes include native enzymes, those enzymes naturally expressed or found in the particular microorganism.
- the terms "derived from” and “obtained from” refer to not only a protease produced or producible by a strain of the organism in question, but also a protease encoded by a DNA sequence isolated from such strain and produced in a host organism containing such DNA sequence. Additionally, the term refers to a protease which is encoded by a DNA sequence of synthetic and/or cDNA origin and which has the identifying characteristics of the protease in question.
- proteases derived from Cellulomonas refers to those enzymes having proteolytic activity which are naturally-produced by Cellulomonas, as well as to serine proteases like those produced by Cellulomonas sources but which through the use of genetic engineering techniques are produced by non- Cellulomonas organisms transformed with a nucleic acid encoding said serine proteases.
- a “derivative" within the scope of this definition generally retains the characteristic proteolytic activity observed in the wild-type, native or parent form to the extent that the derivative is useful for similar purposes as the wild-type, native or parent form.
- Functional derivatives of serine protease encompass naturally occurring, synthetically or recombinantly produced peptides or peptide fragments which have the general characteristics of the serine protease of the present invention.
- the term "functional derivative” refers to a derivative of a nucleic acid which has the functional characteristics of a nucleic acid which encodes serine protease.
- Functional derivatives of a nucleic acid which encode serine protease of the present invention encompass naturally occurring, synthetically or recombinantly produced nucleic acids or fragments and encode serine protease characteristic of the present invention.
- Wild type nucleic acid encoding serine proteases according to the invention include naturally occurring alleles and homologues based on the degeneracy of the genetic code known in the art.
- the term "identical” in the context of two nucleic acids or polypeptide sequences refers to the residues in the two sequences that are the same when aligned for maximum correspondence, as measured using one of the following sequence comparison or analysis algorithms.
- the term “optimal alignment” refers to the alignment giving the highest percent identity score.
- Percent sequence identity refers to the percentage of residues that are identical in the two sequences when the sequences are optimally aligned. Thus, 80% amino acid sequence identity means that 80% of the amino acids in two optimally aligned polypeptide sequences are identical.
- substantially identical in the context of two nucleic acids or polypeptides thus refers to a polynucleotide or polypeptide that comprising at least 70% sequence identity, preferably at least 75%, preferably at least 80%, preferably at least 85%, preferably at least 90%, preferably at least 95% , preferably at least 97% , preferably at least 98% and preferably at least 99% sequence identity as compared to a reference sequence using the programs or algorithms (e.g., BLAST, ALIGN, CLUSTAL) using standard parameters.
- One indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross- reactive with the second polypeptide.
- polypeptides that differ by conservative amino acid substitutions are immunologically cross-reactive.
- a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions (e.g., within a range of medium to high stringency).
- the phrase "equivalent,” in this context, refers to serine proteases enzymes that are encoded by a polynucleotide capable of hybridizing to the polynucleotide having the sequence as shown in SEQ ID NO:1 , under conditions of medium to maximal stringency.
- an equivalent mature serine protease comprises at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and/or at least 99% sequence identity to the mature Cellulomonas serine protease having the amino acid sequence of SEQ ID NO:8.
- isolated or “purified” refers to a material that is removed from its original environment (e.g., the natural environment if it is naturally occurring).
- the material is said to be "purified" when it is present in a particular composition in a higher or lower concentration than exists in a naturally occurring or wild type organism or in combination with components not normally present upon expression from a naturally occurring or wild type organism.
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated.
- Such polynudeotides could be part of a vector, and/or such polynudeotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of its natural environment.
- a nucleic acid or protein is said to be purified, for example, if it gives rise to essentially one band in an elecfrophoretic gel or blot.
- isolated when used in reference to a DNA sequence, refers to a DNA sequence that has been removed from its natural genetic milieu and is thus free of other extraneous or unwanted coding sequences, and is in a form suitable for use within genetically engineered protein production systems. Such isolated molecules are those that are separated from their natural environment and include cDNA and genomic clones. Isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, but may include naturally occurring 5' and 3' untranslated regions such as promoters and terminators.
- an isolated DNA sequence is alternatively referred to as "a cloned DNA sequence".
- isolated when used in reference to a protein, refers to a protein that is found in a condition other than its native environment. In a preferred form, the isolated protein is substantially free of other proteins, particularly other homologous proteins. An isolated protein is more than 10% pure, preferably more than 20% pure, and even more preferably more than 30% pure, as determined by SDS-PAGE.
- the protein in a highly purified form (i.e., more than 40% pure, more than 60% pure, more than 80% pure, more than 90% pure, more than 95% pure, more than 97% pure, and even more than 99% pure), as determined by SDS-PAGE.
- a highly purified form i.e., more than 40% pure, more than 60% pure, more than 80% pure, more than 90% pure, more than 95% pure, more than 97% pure, and even more than 99% pure
- the term, "combinatorial mutagenesis” refers to methods in which libraries of variants of a starting sequence are generated. In these libraries, the variants contain one or several mutations chosen from a predefined set of mutations. In addition, the methods provide means to introduce random mutations which were not members of the predefined set of mutations. In some embodiments, the methods include those set forth in U.S. Patent Appln. Ser. No.
- combinatorial mutagenesis methods encompass commercially available kits (e.g., QuikChange® Multisite, Stratagene, San Diego, CA).
- library of mutants refers to a population of cells which are identical in most of their genome but include different homologues of one or more genes. Such libraries can be used, for example, to identify genes or operons with improved traits.
- starting gene refers to a gene of interest that encodes a protein of interest that is to be improved and/or changed using the present invention. .
- MSA multiple sequence alignment
- consensus sequence and canonical sequence refer to an archetypical amino acid sequence against which all variants of a particular protein or sequence of interest are compared. The terms also refer to a sequence that sets forth the nucleotides that are most often present in a DNA sequence of interest. For each position of a gene, the consensus sequence gives the amino acid that is most abundant in that position in the MSA.
- consensus mutation refers to a difference in the sequence of a starting gene and a consensus sequence.
- Consensus mutations are identified by comparing the sequences of the starting gene and the consensus sequence resulting from an MSA. In some embodiments, consensus mutations are introduced into the starting gene such that it becomes more similar to the consensus sequence. Consensus mutations also include amino acid changes that change an amino acid in a starting gene to an amino acid that is more frequently found in an MSA at that position relative to the frequency of that amino acid in the starting gene. Thus, the term consensus mutation comprises all single amino acid changes that replace an amino acid of the starting gene with an amino acid that is more abundant than the amino acid in the MSA. As used herein, the term "initial hit" refers to a variant that was identified by screening a combinatorial consensus mutagenesis library.
- initial hits have improved performance characteristics, as compared to the starting gene.
- improved hit refers to a variant that was identified by screening an enhanced combinatorial consensus mutagenesis library.
- improving mutation and performance-enhancing mutation refer to a mutation that leads to improved performance when it is introduced into the starting gene.
- these mutations are identified by sequencing hits that were identified during the screening step of the method. In most embodiments, mutations that are more frequently found in hits are likely to be improving mutations, as compared to an unscreened combinatorial consensus mutagenesis library.
- the term "enhanced combinatorial consensus mutagenesis library” refers to a CCM library that is designed and constructed based on screening and/or sequencing results from an earlier round of CCM mutagenesis and screening.
- the enhanced CCM library is based on the sequence of an initial hit resulting from an earlier round of CCM.
- the enhanced CCM is designed such that mutations that were frequently observed in initial hits from earlier rounds of mutagenesis and screening are favored. In some preferred embodiments, this is accomplished by omitting primers that encode performance-reducing mutations or by increasing the concentration of primers that encode performance-enhancing mutations relative to other primers that were used in earlier CCM libraries.
- performance-reducing mutations refer to mutations in the combinatorial consensus mutagenesis library that are less frequently found in hits resulting from screening as compared to an unscreened combinatorial consensus mutagenesis library. In preferred embodiments, the screening process removes and/or reduces the abundance of variants that contain "performance-reducing mutations.”
- functional assay refers to an assay that provides an indication of a protein's activity. In particularly preferred embodiments, the term refers to assay systems in which a protein is analyzed for its ability to function in its usual capacity. For example, in the case of enzymes, a functional assay involves determining the effectiveness of the enzyme in catalyzing a reaction.
- target property refers to the property of the starting gene that is to be altered. It is not intended that the present invention be limited to any particular target property. However, in some preferred embodiments, the target property is the stability of a gene product (e.g., resistance to denaturation, proteolysis or other degradative factors), while in other embodiments, the level of production in a production host is altered. Indeed, it is contemplated that any property of a starting gene will find use in the present invention.
- properties include, but are not limited to, a property affecting binding to a polypeptide, a property conferred on a cell comprising a particular nucleic acid, a property affecting gene transcription (e.g., promoter strength, promoter recognition, promoter regulation, enhancer function), a property affecting RNA processing (e.g., RNA splicing, RNA stability, RNA conformation, and post-transcriptional modification), a property affecting translation (e.g., level, regulation, binding of mRNA to ribosomal proteins, post- translational modification).
- a binding site for a transcription factor, polymerase, regulatory factor, etc., of a nucleic acid may be altered to produce desired characteristics or to identify undesirable characteristics.
- polypeptide refers to any characteristic or attribute of a polypeptide that can be selected or detected. These properties include, but are not limited to oxidative stability, substrate specificity, catalytic activity, thermal stability, alkaline stability, pH activity profile, resistance to proteolytic degradation, K M , k cat , k cat /k M ratio, protein folding, inducing an immune response, ability to bind to a ligand, ability to bind to a receptor, ability to be secreted, ability to be displayed on the surface of a cell, ability to oligomerize, ability to signal, ability to stimulate cell proliferation, ability to inhibit cell proliferation, ability to induce apoptosis, ability to be modified by phosphorylation or glycosylation, ability to treat disease.
- the term "screening" has its usual meaning in the art and is, in general a multi-step process.
- a mutant nucleic acid or variant polypeptide therefrom is provided.
- a property of the mutant nucleic acid or variant polypeptide is determined.
- the determined property is compared to a property of the corresponding precursor nucleic acid, to the property of the corresponding naturally occurring polypeptide or to the property of the starting material (e.g., the initial sequence) for the generation of the mutant nucleic acid.
- the screening procedure for obtaining a nucleic acid or protein with an altered property depends upon the property of the starting material the modification of which the generation of the mutant nucleic acid is intended to facilitate.
- the skilled artisan will therefore appreciate that the invention is not limited to any specific property to be screened for and that the following description of properties lists illustrative examples only. Methods for screening for any particular property are generally described in the art. For example, one can measure binding, pH, specificity, etc., before and after mutation, wherein a change indicates an alteration.
- the screens are performed in a high-throughput manner, including multiple samples being screened simultaneously, including, but not limited to assays utilizing chips, phage display, and multiple substrates and/or indicators.
- screens encompass selection steps in which variants of interest are enriched from a population of variants.
- these embodiments include the selection of variants that confer a growth advantage to the host organism, as well as phage display or any other method of display, where variants can be captured from a population of variants based on their binding or catalytic properties.
- a library of variants is exposed to stress (heat, protease, denaturation) and subsequently variants that are still intact are identified in a screen or enriched by selection. It is intended that the term encompass any suitable means for selection. Indeed, it is not intended that the present invention be limited to any particular method of screening.
- targeted randomization refers to a process that produces a plurality of sequences where one or several positions have been randomized.
- randomization is complete (i.e., all four nucleotides, A, T, G, and C can occur at a randomized position.
- randomization of a nucleotide is limited to a subset of the four nucleotides.
- Targeted randomization can be applied to one or several codons of a sequence, coding for one or several proteins of interest. When expressed, the resulting libraries produce protein populations in which one or more amino acid positions can contain a mixture of all 20 amino acids or a subset of amino acids, as determined by the randomization scheme of the randomized codon.
- the individual members of a population resulting from targeted randomization differ in the number of amino acids, due to targeted or random insertion or deletion of codons.
- synthetic amino acids are included in the protein populations produced.
- the majority of members of a population resulting from targeted randomization show greater sequence homology to the consensus sequence than the starting gene.
- the sequence encodes one or more proteins fo interest.
- the proteins have differing biological functions.
- the incoming sequence comprises at least one selectable marker.
- the expression product of the modified sequence is a truncated protein (e.g., if the modification is a deletion or interruption of the sequence). In some particularly preferred embodiments, the truncated protein retains biological activity. In alternative embodiments, the expression product of the modified sequence is an elongated protein (e.g., modifications comprising an insertion into the nucleic acid sequence). In some embodiments, an insertion leads to a truncated protein (e.g., when the insertion results in the formation of a stop codon). Thus, an insertion may result in either a truncated protein or an elongated protein as an expression product.
- mutant sequence and “mutant gene” are used interchangeably and refer to a sequence that has an alteration in at least one codon occurring in a host cell's wild-type sequence.
- the expression product of the mutant sequence is a protein with an altered amino acid sequence relative to the wild-type.
- the expression product may have an altered functional capacity (e.g., enhanced enzymatic activity).
- mutagenic primer or “mutagenic oligonucleotide” (used interchangeably herein) are intended to refer to oligonucleotide compositions which correspond to a portion of the template sequence and which are capable of hybridizing thereto.
- non-mutagenic primer or “non-mutagenic oligonucleotide” refers to oligonucleotide compositions which will match precisely to the template nucleic acid. In one embodiment of the invention, only mutagenic primers are used. In another preferred embodiment of the invention, the primers are designed so that for at least one region at which a mutagenic primer has been included, there is also non- mutagenic primer included in the oligonucleotide mixture.
- the non-mutagenic primers provide the ability to obtain a specific level of non-mutant members within the nucleic acid library for a given residue.
- the methods of the invention employ mutagenic and non-mutagenic oligonucleotides which are generally between 10-50 bases in length, more preferably about 15-45 bases in length.
- primers that are either shorter than 10 bases or longer than 50 bases to obtain the mutagenesis result desired.
- corresponding mutagenic and non-mutagenic primers it is not necessary that the corresponding oligonucleotides be of identical length, but only that there is overlap in the region corresponding to the mutation to be added.
- Primers may be added in a pre-defined ratio according to the present invention. For example, if it is desired that the resulting library have a significant level of a certain specific mutation and a lesser amount of a different mutation at the same or different site, by adjusting the amount of primer added, it is possible to produce the desired biased library.
- the phrase "contiguous mutations” refers to mutations which are presented within the same oligonucleotide primer. For example, contiguous mutations may be adjacent or nearby each other, however, they will be introduced into the resulting mutant template nucleic acids by the same primer.
- the phrase "discontiguous mutations” refers to mutations which are presented in separate oligonucleotide primers. For example, discontiguous mutations will be introduced into the resulting mutant template nucleic acids by separately prepared oligonucleotide primers.
- wild-type sequence or wild-type gene
- wild-type sequence refers to a sequence that is native or naturally occurring in a host cell.
- the wild-type sequence refers to a sequence of interest that is the starting point of a protein engineering project.
- the wild-type sequence may encode either a homologous or heterologous protein.
- a homologous protein is one the host cell would produce without intervention.
- a heterologous protein is one that the host cell would not produce but for the intervention.
- antibodies refers to immunoglobulins. Antibodies include but are not limited to immunoglobulins obtained directly from any species from which it is desirable to produce antibodies.
- the present invention encompasses modified antibodies.
- antibody fragments that retain the ability to bind to the epitope that the intact antibody binds and include polyclonal antibodies, monoclonal antibodies, chimeric antibodies, anti-idiotype (anti-ID) antibodies.
- Antibody fragments include, but are not limited to the complementarity-determining regions (CDRs), single-chain fragment variable regions (scFv), heavy chain variable region (VH), light chain variable region (VL).
- CDRs complementarity-determining regions
- scFv single-chain fragment variable regions
- VH heavy chain variable region
- VL light chain variable region
- Polyclonal and monoclonal antibodies are also encompassed by the present invention.
- the antibodies are monoclonal antibodies.
- oxidation stable refers to proteases of the present invention that retain a specified amount of enzymatic activity over a given period of time under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention, for example while exposed to or contacted with bleaching agents or oxidizing agents.
- the proteases retain at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% proteolytic activity after contact with a bleaching or oxidizing agent over a given time period, for example, at least 1 minute, 3 minutes, 5 minutes, 8 minutes, 12 minutes, 16 minutes, 20 minutes, etc.
- the stability is measured as described in the Examples.
- chelator stable refers to proteases of the present invention that retain a specified amount of enzymatic activity over a given period of time under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention, for example while exposed to or contacted with chelating agents.
- the proteases retain at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% proteolytic activity after contact with a chelating agent over a given time period, for example, at least 10 minutes, 20 minutes, 40 minutes, 60 minutes, 100 minutes, etc.
- the chelator stability is measured as described in the Examples.
- thermostability refers to proteases of the present invention that retain a specified amount of enzymatic activity after exposure to identified temperatures over a given period of time under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention, for example while exposed altered temperatures. Altered temperatures includes increased or decreased temperatures!
- the proteases retain at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% proteolytic activity after exposure to altered temperatures over a given time period, for example, at least 60 minutes, 120 minutes, 180 minutes, 240 minutes, 300 minutes, etc.
- the thermostability is determined as described in the Examples.
- impaired stability in the context of an oxidation, chelator, thermal and/or pH stable protease refers to a higher retained proteolytic activity over time as compared to other serine proteases (e.g., subtilisin proteases) and/or wild-type enzymes.
- diminished stability in the context of an oxidation, chelator, thermal and/or pH stable protease refers to a lower retained proteolytic activity over time as compared to other serine proteases (e.g., subtilisin proteases) and/or wild-type enzymes.
- cleaning composition includes, unless otherwise indicated, granular or powder-form all-purpose or "heavy-duty” washing agents, especially cleaning detergents; liquid, gel or paste-form all-purpose washing agents, especially the so- called heavy-duty liquid types; liquid fine-fabric detergents; hand dishwashing agents or light duty dishwashing agents, especially those of the high-foaming type; machine dishwashing agents, including the various tablet, granular, liquid and rinse-aid types for household and institutional use; liquid cleaning and disinfecting agents, including antibacterial hand-wash types, cleaning bars, mouthwashes, denture cleaners, car or carpet shampoos, bathroom cleaners; hair shampoos and hair-rinses; shower gels and foam baths and metal cleaners; as well as cleaning auxiliaries such as bleach additives and "stain-stick" or pre-treat types.
- cleaning activity refers to the cleaning performance achieved by the protease under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention.
- cleaning performance is determined by the application of various cleaning assays concerning enzyme sensitive stains, for example grass, blood, milk, or egg protein as determined by various chromatographic, spectrophotometric or other quantitative methodologies after subjection of the stains to standard wash conditions.
- Exemplary assays include, but are not limited to those described in WO 99/34011 , and U.S. Pat. 6,605,458 (both of which are herein incorporated by reference), as well as those methods included in the Examples.
- cleaning effective amount refers to the quantity of protease described hereinbefore that achieves a desired level of enzymatic activity in a specific cleaning composition. Such effective amounts are readily ascertained by one of ordinary skill in the art and are based on many factors, such as the particular protease used, the cleaning application, the specific composition of the cleaning composition, and whether a liquid or dry (e.g., granular, bar) composition is required, etc.
- cleaning adjunct materials means any liquid, solid or gaseous material selected for the particular type of cleaning composition desired and the form of the product (e.g., liquid, granule, powder, bar, paste, spray, tablet, gel; or foam composition), which materials are also preferably compatible with the protease enzyme used in the composition.
- granular compositions are in "compact” form, while in other embodiments, the liquid compositions are in a "concentrated” form.
- enhanced performance in the context of cleaning activity refers to an increased or greater cleaning activity of certain enzyme sensitive stains such as egg, milk, grass or blood, as determined by usual evaluation after a standard wash cycle and/or multiple wash cycles.
- subtilisin protease e.g., commercially available proteases
- OPTIMASETM protease Genencor
- PURAFECT TM protease products Genencor
- SAVINASE SAVINASE TM protease (Novozymes)
- BPN'-variants See e.g., U.S. Pat. No.
- Re 34,606 RELASETM, DURAZYMETM, EVERLASETM, KANNASE TM protease (Novozymes), MAXACALTM, MAXAPEMTM, PROPERASE TM proteases (Genencor; See also, U.S. Pat. No. Re 34,606, U.S. Pat. Nos. 5,700,676; 5,955,340; 6,312,936; 6,482,628), and B. lentus variant protease products [for example those described in WO 92/21760, WO 95/23221 and/or WO 97/07770 (Henkel).
- Exemplary subtilisin protease variants include, but are not limited to those having substitutions or deletions at residue positions equivalent to positions 76, 101 , 103, 104, 120, 159, 167, 170, 194, 195, 217, 232, 235, 236, 245, 248, and/or 252 of BPN'.
- Cleaning performance can be determined by comparing the proteases of the present invention with those subtilisin proteases in various cleaning assays concerning enzyme sensitive stains such as grass, blood or milk as determined by usual spectrophotometric or analytical methodologies after standard wash cycle conditions.
- a "low detergent concentration" system includes detergents where less than about 800 ppm of detergent components are present in the wash water.
- Japanese detergents are typically considered low detergent concentration systems, as they have usually have approximately 667 ppm of detergent components present in the wash water.
- a "medium detergent concentration” systems includes detergents wherein between about 800 ppm and about 2000ppm of detergent components are present in the wash water.
- North American detergents are generally considered to be medium detergent concentration systems as they have usually approximately 975 ppm of detergent components present in the wash water.
- Brazilian detergents typically have approximately 1500 ppm of detergent components present in the wash water.
- “high detergent concentration” systems includes detergents wherein greater than about 2000 ppm of detergent components are present in the wash water.
- European detergents are generally considered to be high detergent concentration systems as they have approximately 3000-8000 ppm of detergent components in the wash water.
- fabric cleaning compositions include hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the soaking and/or pretreatment of stained fabrics (e.g., clothes, linens, and other textile materials).
- non-fabric cleaning compositions include non-textile (i.e., fabric) surface cleaning compositions, including but not limited to dishwashing detergent compositions, oral cleaning compositions, denture cleaning compositions, and personal cleansing compositions.
- the "compact" form of the cleaning compositions herein is best reflected by density and, in terms of composition, by the amount of inorganic filler salt.
- Inorganic filler salts are conventional ingredients of detergent compositions in powder form.
- the filler salts are present in substantial amounts, typically 17-35% by weight of the total composition. In contrast, in compact compositions, the filler salt is present in amounts not exceeding 15% of the total composition. In some embodiments, the filler salt is present in amounts that do not exceed 10%, or more preferably, 5%, by weight of the composition.
- the inorganic filler salts are selected from the alkali and alkaline-earth-metal salts of sulfates and chlorides. A preferred filler salt is sodium sulfate.
- the present invention provides isolated polynudeotides encoding amino acid sequences, encoding proteases.
- these polynudeotides comprise at least 65% amino acid sequence identity, preferably at least 70% amino acid sequence identity, more preferably at least 75% amino acid sequence identity, still more preferably at least 80% amino acid sequence identity, more preferably at least 85% amino acid sequence identity, even more preferably at least 90% amino acid sequence identity, more preferably at least 92% amino acid sequence identity, yet more preferably at least 95% amino acid sequence identity, more preferably at least 97% amino acid sequence identity, still more preferably at least 98% amino acid sequence identity, and most preferably at least 99% amino acid sequence identity to an amino acid sequence as shown in SEQ ID NOS:6-8, (e.g., at least a portion of the amino acid sequence encoded by the polynucleotide having proteolytic activity, including the mature protease cata
- the percent identity is determined by a direct comparison of the sequence information between two molecules by aligning the sequences, counting the exact number of matches between the two aligned sequences, dividing by the length of the shorter sequence, and multiplying the result by 100.
- Readily available computer programs find use in these analysis, such as those described above.
- Programs for determining nucleotide sequence identity are available in the Wisconsin Sequence Analysis Package, Version 8 (Genetics Computer Group, Madison, WI) for example, the BESTFIT, FASTA and GAP programs, which also rely on the Smith and Waterman algorithm. These programs are readily utilized with the default parameters recommended by the manufacturer and described in the Wisconsin Sequence Analysis Package referred to above.
- HSPs high scoring sequence pairs
- the word hits are expanded in both directions along each of the two sequences being compared for as far as the cumulative alignment score can be increased. Extension of the word hits is stopped when: the cumulative alignment score falls off by the quantity X from a maximum achieved value; the cumulative score goes to zero or below; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST program uses as defaults a wordlength (W) of 11 , the BLOSUM62 scoring matrix (See, Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M'5, N'-4, and a comparison of both strands.
- the BLAST algorithm then performs a statistical analysis of the similarity between, two sequences (See e.g., Karlin and Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 [1993]).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- a nucleic acid is considered similar to a serine protease nucleic acid of this invention if the smallest sum probability in a comparison of the test nucleic acid to a serine protease nucleic acid is less than about 0.1, more preferably less than about 0.01 , and most preferably less than about 0.001.
- the test nucleic acid encodes a serine protease polypeptide
- it is considered similar to a specified serine protease nucleic acid if the comparison results in a smallest sum probability of less than about 0.5, and more preferably less than about 0.2.
- sequences were analyzed by BLAST and protein translation sequence tools.
- the preferred version was BLAST (Basic BLAST version 2.0).
- the program chosen was "BlastX”, and the database chosen was "nr”. Standard/default parameter values were employed.
- the present invention encompasses the approximately 1621 base pairs in length polynucleotide set forth in SEQ. ID NO:1. A start codon is shown in bold in SEQ ID NO:1.
- the polynudeotides encoding these amino acid sequences comprise a 1485 base pair portion (residues 1-1485 of SEQ ID NO:2) that, if expressed, is believed to encode a signal sequence (nucleotides 1-84 of SEQ ID NO:5) encoding amino acids 1-28 of SEQ ID NO:9; an N-terminal prosequence (nucleotides 84-594 encoding amino acid residues 29-198 of SEQ ID NO:6); a mature protease sequence (nucleotides 595-1161 of SEQ ID NO:2 encoding amino acid residues 1-189 of SEQ ID NO:8); and a C-terminal pro-sequence (nucleotides 1162-1486 encoding amino acid residues 388-495 of SEQ ID NO:6).
- the signal peptide, the N-terminal pro-sequence, mature serine protease sequence and C-terminal pro-sequence is numbered in relation to the amino acid residues of the mature protease of SEQ ID NO:6 being numbered 1-189, i.e., signal peptide (residues -198 to -171 ), an N-terminal pro sequence (residues -171 to -1), the mature serine protease sequence (residues 1-189) and a C-terminal pro-sequence (residues 190-298).
- the polynucleotide encoding an amino acid sequence having proteolytic activity comprises a nucleotide sequence of nucleotides 1 to 1485 of the portion of SEQ ID NO:2 encoding the signal peptide and precursor protease.
- the polynucleotide encoding an amino acid sequence comprises the sequence of nucleotides 1 to 1412 of the polynucleotide encoding the precursor Cellulomonas protease (SEQ ID NO:3).
- the polynucleotide encoding an amino acid sequence comprises the sequence of nucleotides 1 to 587 of the portion of the polynucleotide encoding the mature Cellulomonas protease (SEQ ID NO:4).
- SEQ ID NO:4 the mature Cellulomonas protease
- a variety of polynudeotides can encode the signal peptide, precursor protease and/or mature protease provided in SEQ ID NOS:6, 7, and/or 8, respectively, or a protease having the % sequence identity described above.
- Another embodiment of the present invention encompasses a polynucleotide comprising a nucleotide sequence having at least 70% sequence identity, at least 75% sequence identity, at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 92% sequence identity, at least 95% sequence identity, at least 97% sequence identity, at least 98% sequence identity and at least 99% sequence identity to the polynucleotide sequence of SEQ ID NOS:2, 3, and/or 4, respectively, encoding the signal peptide and precursor protease, the precursor protease and/or the mature protease, respectively.
- the present invention provides fragments or portions of DNA that encodes proteases, so long as the encoded fragment retains proteolytic activity.
- Another embodiment of the present invention encompasses polynudeotides having at least 20% of the sequence length, at least 30% of the sequence length, at least 40% of the sequence length, at least 50% of the sequence length, at least 60% of the sequence length, 70% of the sequence length, at least 75% of the sequence length, at least 80% of the sequence length, at least 85% of the sequence length, at least 90% of the sequence length, at least 92% of the sequence length, at least 95% of the sequence length, at least 97% of the sequence length, at least 98% of the sequence length and at least 99% of the sequence of the polynucleotide sequence of SEQ ID NO:2, or residues 185-1672 of SEQ ID NO:1 , encoding the precursor protease.
- these fragments or portions of the sequence length are contiguous portions of the sequence length, useful for shuffling of the DNA sequence in recombinant DNA sequences (See e.g., U.S. Pat. No. 6,132,970)
- Another embodiment of the invention includes fragments of the DNA described herein that find use according to art recognized techniques in obtaining partial length DNA fragments capable of being used to isolate or identify polynudeotides encoding mature protease enzyme described herein from Cellulomonas 69B4, or a segment thereof having proteolytic activity.
- the DNA provided in SEQ ID NO:1 finds use in identifying homologous fragments of DNA from other species, and particularly from Cellulomonas spp.
- the present invention encompasses using primer or probe sequences constructed from SEQ ID NO:1 , or a suitable portion or fragment thereof (e.g., at least about 5-20 or 10-15 contiguous nucleotides), as a probe or primer for screening nucleic acid of either genomic or cDNA origin.
- the present invention provides DNA probes of the desired length (i.e., generally between 100 and 1000 bases in length), based on the sequences in SEQ ID NOS1, 2, 3, and/or 4.
- the DNA fragments are electrophoretically isolated, cut from the gel, and recovered from the agar matrix of the gel.
- this purified fragment of DNA is then labeled (using, for example, the Megaprime labeling system according to the instructions of the manufacturer) to incorporate P 32 in the DNA.
- the labeled probe is denatured by heating to 95 ° C for a given period of time (e.g., 5 minutes), and immediately added to the membrane and prehybridization solution.
- the hybridization reaction proceeds for an appropriate time and under appropriate conditions (e.g., 18 hours at 37 S C), with gentle shaking or rotation.
- the membrane is rinsed (e.g., twice in SSC/0.3% SDS) and then washed in an appropriate wash solution with gentle agitation.
- the stringency desired is a reflection of the conditions under which the membrane (filter) is washed.
- low-stringency conditions involve washing with a solution of 0.2X SSC/0.1% SDS at 20°C for 15 minutes
- intermediate-stringency conditions involve a further washing step comprising washing with a solution of 0.2X SSC/0.1% SDS at 37 ° C for 30 minutes
- high-stringency conditions involve a further washing step comprising washing with a solution of 0.2X SSC/0.1% SDS at 37°C for 45 minutes
- maximum-stringency conditions involve a further washing step comprising washing with a solution of 0.2X SSC/0.1% SDS at 37°C for 60 minutes.
- various embodiments of the present invention provide polynudeotides capable of hybridizing to a probed derived from the nucleotide sequence provided in SEQ ID NOS:1 , 2, 3, 4, and/or 5, under conditions of medium, high and/or maximum stringency. After washing, the membrane is dried and the bound probe detected. If P 32 or another radioisotope is used as the labeling agent, the bound probe is detected by autoradiography. Other techniques for the visualization of other probes are well-known to those of skill in the art. The detection of a bound probe indicates a nucleic acid sequence has the desired homology, and therefore identity to SEQ ID NOS:1 , 2, 3, 4, and/or 5, and is encompassed by the present invention.
- the present invention provides methods for the detection of nucleic acid encoding a protease encompassed by the present invention which comprises hybridizing part or all of a nucleic acid sequence of SEQ ID NOS:1, 2, 3, 4, and/or 5 with other nucleic acid of either genomic or cDNA origin.
- hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex, to confer a defined
- “stringency” as explained below. “Maximum stringency” typically occurs at about Tm-5°C (5°C below the Tm of the probe); “high stringency” at about 5°C to 10 ° C below Tm; “intermediate stringency” at about 10 ° C to 20 ° C below Tm; and “low stringency” at about 20° C to 25°C below Tm.
- medium, high and/or maximum stringency hybridization are chosen such that conditions are optimized to identify or detect polynucleotide sequence homologues or equivalent polynucleotide sequences.
- the present invention provides nucleic acid constructs (i.e., expression vectors) comprising the polynudeotides encoding the proteases of the present invention.
- the present invention provides host cells transformed with at least one of these vectors.
- the present invention provides polynucleotide sequences further encoding a signal sequence.
- invention encompasses polynudeotides having signal activity comprising a nucleotide sequence having at least 65% sequence identity, at least 70% sequence identity, preferably at least 75% sequence identity, more preferably at least 80% sequence identity, still further preferably at least 85% sequence identity, even more preferably at least 90% sequence identity, more preferably at least 95% sequence identity, more preferably at least 97% sequence identity, at least 98% sequence identity, and most preferably at least 99% sequence identity to SEQ ID NO:5.
- the present invention provides a sequence with a putative signal sequence, and polynudeotides being capable of hybridizing to a probe derived from the nucleotide sequence disclosed in SEQ ID NO:5 under conditions of medium, high and/or maximal stringency, wherein the signal sequences have substantially the same signal activity as the signal sequence encoded by the polynucleotide of the present invention.
- the signal activity is indicated by substantially the same level of secretion of the protease into the fermentation medium, as the starting material.
- the present invention provides fermentation medium protease levels at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% of the secreted protease levels in the fermentation medium as provided by the signal sequence of SEQ ID NO:3.
- the secreted protease levels are ascertained by protease activity analyses such as the pNA assay (See e.g., Del Mar, [1979], infra). Additional means for determining the levels of secretion of a heterologous or homologous protein in a Gram-positive host cell and detecting secreted proteins include using either polyclonal or monoclonal antibodies specific for the protein.
- the present invention provides polynudeotides, encoding an amino acid sequence of a signal peptide (nucleotides 1-84 of SEQ ID NO:5), as shown in SEQ ID NO:9, nucleotide residue positions 1 to 85 of SEQ ID NO:2, and /or SEQ ID NO:5.
- the invention further encompasses nucleic acid sequences which hybridize to the nucleic acid sequence shown in SEQ ID NO:5 under low, medium, high stringency and/or maximum stringency conditions, but which have substantially the same signal activity as the sequence.
- the present invention encompasses all such polynudeotides.
- the present invention provides polynudeotides that are complementary to the nucleotide sequences described herein.
- Exemplary complementary nucleotide sequences include those that are provided in SEQ ID NOS: 1-5.
- polypeptides having proteolytic activity comprising 65% amino acid sequence identity, at least 70% sequence identity, at least 75% amino acid sequence identity, at least 80% amino acid sequence identity, at least 85% amino acid sequence identity, at least 90% amino acid sequence identity, at least 92% amino acid sequence identity, at least 95% amino acid sequence identity, at least 97% amino acid sequence identity, at least 98% amino acid sequence identity and at least 99% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 6 (i.e., the signal and precursor protease), SEQ ID NO:7 (i.e., the precursor protease), and/or of SEQ ID NO:8 (i.e., the mature protease).
- SEQ ID NO: 6 i.e., the signal and precursor protease
- SEQ ID NO:7 i.e., the precursor protease
- SEQ ID NO:8 i.e., the mature protease
- the proteolytic activity of these polypeptides is determined using methods known in the art and include such methods as those used to assess detergent function.
- the polypeptides are isolated.
- the polypeptides comprise amino acid sequences that identical to amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS:6, 7, or 8.
- the polypeptides are identical to portions of SEQ ID NOS:6, 7 or 8.
- the present invention provides isolated polypeptides having proteolytic activity, comprising the amino acid sequence approximately 495 amino acids in length, as provided in SEQ ID NO:6.
- the present invention encompasses polypeptides having proteolytic activity comprising the amino acid sequence approximately 467 amino acids in length provided in SEQ ID NO:7.
- these amino acid sequences comprise a signal sequence (amino acids 1-28 of SEQ ID NO:9); and a precursor protease (amino acids 1-467 of SEQ ID NO:7).
- the present invention encompasses polypeptides comprising an N-terminal prosequence (amino acids 1-170 of SEQ ID NO:7), a mature protease sequence (amino acids 1-189 of SEQ ID NO:8), and a C-terminal prosequence (amino acids 360 -467 of SEQ ID NO:7).
- the present invention encompasses polypeptides comprising a precursor protease sequence (e.g., amino acids 1-467 of SEQ ID NO:7). In yet another embodiment, the present invention encompasses polypeptides comprising a mature protease sequence comprising amino acids (e.g., 1-189 of SEQ ID NO:8). In further embodiments, the present invention provides polypeptides and/or proteases comprising amino acid sequences of the above described sequence derived from bacterial species including, but not limited to Micrococcineae which are identified through amino acid sequence homology studies.
- an amino acid residue of a precursor Micrococcineae protease is equivalent to a residue of Cellulomonas strain 69B4, if it is either homologous (i.e., corresponding in position in either primary or tertiary structure) or analogous to a specific residue or portion of that residue in Cellulomonas strain 69B4 protease (i.e., having the same or similar functional capacity to combine, react, or interact chemically).
- the amino acid sequence of a precursor protease is directly compared to the Cellulomonas strain 69B4 mature protease amino acid sequence and particularly to a set of conserved residues which are discerned to be invariant in all or a large majority of Cellulomonas like proteases for which sequence is known.
- the residues corresponding to particular amino acids in the mature protease (SEQ ID NO:8) and Cellulomonas 69B4 protease are determined.
- Alignment of conserved residues preferably should conserve 100% of such residues. However, alignment of greater than 75% or as little as 45% of conserved residues is also adequate to define equivalent residues. However, conservation of the catalytic triad, His32/Asp56/Ser137 of SEQ ID NO:8 should be maintained.
- the amino acid sequence of proteases from Cellulomonas strain 69B4, and other Micrococcineae spp. described above are aligned to provide the maximum amount of homology between amino acid sequences. A comparison of these sequences indicates that there are a number of conserved residues contained in each sequence.
- the equivalent amino acid for the catalytic triad e.g., in Cellulomonas 69B4 protease
- the protease homologs comprise the equivalent of His32/Asp56/Ser137 of SEQ ID NO:8.
- Another indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross-reactive with the second polypeptide. Methodologies for determining immunological cross-reactivity are described in the art and are described in the Examples herein.
- polypeptides that differ by conservative amino acid substitutions are immunologically cross-reactive.
- a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution.
- the present invention encompasses proteases obtained from various sources.
- the proteases are obtained from bacteria, while in other embodiments, the proteases are obtained from fungi.
- the bacterial source is selected from the members of the suborder Micrococcineae.
- the bacterial source is the family Promicromonosporaceae. In some preferred embodiments, the Promicromonosporaceae spp.
- DSM 43110 includes and/or is selected from the group consisting of Promicromonospora citrea (DSM 43110), Promicromonospora sukumoe (DSM 44121), Promicromonospora aerolata (CCM 7043), Promicromonospora vindobonensis (CCM 7044), Myceligenerans xiligouense (DSM 15700), Isoptehcola variabilis (DSM 10177, basonym Cellulosimicrobium variabile), Cellulosimicrobium cellulans (DSM 20424, basonym Nocardia cellulans, Cellulomonas cellulans), Cellulosimicrobium funkei, Xylanimonas cellulosilytica (LMG 20990), Xylanibacterium ulmi (LMG 21721), and Xylanimicrobium pachnodae (DSM 12657, basonym Promicromonospora pachnodae
- the bacterial source is the family Cellulomonadaceae.
- the Cellulomonadaceae spp. includes and/or is selected from the group of Cellulomonas fimi (ATCC 484, DSM 20113), Cellulomonas biazotea (ATCC 486, DSM 20112), Cellulomonas cellasea (ATCC 487, 21681, DSM 20118), Cellulomonas denverensis, Cellulomonas hominis (DSM 9581), Cellulomonas flavigena (ATCC 482, DSM 20109), Cellulomonas persica (ATCC 700642, DSM 14784), Cellulomonas iranensis (ATCC 700643, DSM 14785); Cellulomonas fermentans (ATCC 43279, DSM 3133), Cellulomonas gelida (ATCC 488, DSM 20111 , DSM 20110
- the bacterial source also includes and/or is selected from the group of Thermobifida spp., Rarobacter spp., and/or Lysobacter spp.
- the Thermobifida spp. is Thermobifida fusca (basonym Thermomonospora fusca) (tfpA, AAC23545; See, Lao et. al, Appl. Environ. Microbiol., 62: 4256-4259 [1996]).
- the Lysobacter spp. is Lysobacter enzymogenes.
- the present invention provides polypeptides and/or polynudeotides obtained and/or isolated from fungal sources.
- the fungal source includes a Metarhizium spp.
- the fungal source is a Metarhizium anisopliae (CHY1 (CAB60729).
- the present invention provides polypeptides and/or polynudeotides derived from a Cellulomonas strain selected from cluster 2 of the taxonomic classification described in U.S. Pat. No 5,401,657, herein incorporated by reference.
- a Cellulomonas strain selected from cluster 2 of the taxonomic classification described in U.S. Pat. No 5,401,657, herein incorporated by reference.
- twenty strains of bacteria isolated from in and around alkaline lakes were assigned to the type of bacteria known as Gram-positive bacteria on the basis of: (1) the Dussault modification of the Gram's staining reaction (Dussault, J. Bacteriol., 70:484-485 [1955]); (2) the KOH sensitivity test (Gregersen, Eur. J. Appl. Microbiol.
- the phenetic data consisting of 200 unit characters was scored and set out in the form of an "n.times.t" matrix, whose t columns represent the "t" bacterial strains to be grouped on the basis of resemblances, and whose "n” rows are the unit characters.
- Taxonomic resemblance of the bacterial strains was estimated by means of a.similarity coefficient (Sneath and Sokal, supra, pp. 114-187). Although many different coefficients have been used for biological classification, only a few have found regular use in bacteriology. Three association coefficients (See e.g., Sneath and Sokal, supra, at p.
- the Gower Coefficient was chosen over other coefficients for generating similarity matrices because it is applicable to all types of characters or data, namely, two-state, multistate (ordered and qualitative), and quantitative.
- Cluster analysis of the similarity matrix was accomplished using the Unweighted Pair Group Method with Arithmetic Averages (UPGMA) algorithm, also known as the Unweighted Average Linkage procedure, by running the SMATCLST sub-routine in TAXPAK.
- Dendrograms illustrate the levels of similarity between bacterial strains In some embodiments, dendrograms are obtained by using the DENDGR program in TAXPAK.
- the phenetic data were re-analyzed using the Jaccard Coefficient (Sj) (Sneath and Sokal, supra, al p.131) and Simple Matching Coefficient (S SM ) (Sneath, P.H.A. and Sokal, R.R., ibid, p. 132) by running the RTBNSIM program in TAXPAK.
- Sj Jaccard Coefficient
- S SM Simple Matching Coefficient
- An additional two dendrograms were obtained by using the SMATCLST with UPGMA option and DENDGR sub-routines in TAXPAK.
- S G /UPGMA method six natural clusters or phenons of alkalophilic bacteria were generated at the 79% similarity level. These six clusters included 15 of the 20 alkalophilic bacteria isolated from alkaline lakes.
- This program tests the significance of all dichotomous pairs of clusters (comprising 4 or more strains) in a UPGMA. generated dendrogram with Squared Euclidean distances, or their complement as a measurement and assuming that the clusters are hyperspherical. The critical overlap was set at 0.25%. The separation of the clusters is highly significant.
- the Sj coefficient is a useful adjunct to the S G coefficient, as it can be used to detect phenons in the latter that are based on negative matches or distortions owing to undue weight being put on potentially subjective qualitative data. Consequently, the Sj coefficient is useful for confirming the validity of clusters defined initially by the use of the S G coefficient.
- the Jaccard Coefficient is particularly useful in comparing biochemically unreactive organisms (Austin and Priest, supra, at p. 37). In addition, there may be some question about the admissibility of matching negative character states (See, Sneath and Sokal, supra, at p. 131), in which case the Simple Matching Coefficient is a widely applied alternative.
- Strain 69B4 was classified as in cluster 2 by this method. In the main, all of the clusters (especially the clusters of the new bacteria) generated by the S G /UPGMA method were recovered in the dendrograms produced by the Sj /UPGMA method (cophenetic correlation, 0.795), and the S SM /UPGMA method (cophenetic correlation, 0.814).
- the polynucleotide is derived from a bacteria having a 16S rRNA gene nucleotide sequence at least 70%, 75%, 80%, 85%, 88%, 90%, 92%, 95%, 98% sequence identity with the 16S rRNA gene nucleotide sequence of Cellulomonas strain 69B4.
- FIG. 1 The sequence of the 16S rRNA gene is deposited at GenBank under Accession Number X92152.
- Figure 1 provides an unrooted phylogenetic tree illustrating the relationship of novel strain 69B4 to members of the family Cellulomonadaceae (including Cellulomonas strain 69B4) and other related genera of the suborder Micrococcineae.
- the dendrogram was constructed from aligned 16S rDNA sequences (1374 nt) using TREECONW v.1.3b (Van de Peer and De Wachter, Comput. Appl. Biosci., 10: 569-570 [1994]).
- the strain 69B4 exhibits the closest 16S rDNA relationship to members of Cellulomonas and Oerskovia of the family Cellulomonadaceae.
- the closest relatives are believed to be C. cellasea (DSM 20118) and C. fimi (DSM 20113), with at least 95% sequence identity with the 16S rRNA gene nucleotide sequence of Cellulomonas strain 69B4 (e.g., 96% and 95% identity respectively) to strain 69B4 16S rRNA gene sequence.
- the Cellulomonas spp. is Cellulomonas strain 69B4 (DSM16035).
- the strain also appeared to be negative in standard oxidase, urease, aminopeptidase, and KOH tests. In addition, nitrate was not reduced, although the organisms were catalase positive and DNase was produced under alkaline conditions.
- the preferred temperature range for growth was 20 - 37°C, with an optimum temperature at around 30-37°C. No growth was observed at 15°C or 45°C.
- the strain is alkalophilic and slightly halophilic.
- the strain may also be characterized as having growth occurring at pH values between 6.0 and 10.5 with an optimum around pH 9-10. No growth was observed at pH 11 or pH 5.5. Growth below pH 7 was less vigorous and abundant than that of cultures grown at the optimal temperature.
- the strain was observed to grow in medium containing 0-8% (w/v) NaCl. Furthermore, the strain may also be characterized as a chemo-organotroph, since it grew on complex substrates such as yeast extract and peptone; and hydrolyzed starch, gelatin, casein, carboxymethylcellulose and amorphous cellulose. The strain was observed to have metabolism that was respiratory and also fermentative.
- Acid was produced both aerobically and anaerobically from (API 50CH): L- arabinose, D-xylose, D-glucose, D-fructose, D-mannose, rhamnose (weak), cellobiose, maltose, sucrose, trehalose, gentiobiose, D-turanose, D-lyxose and 5-keto-gluconate (weak). Amygdalin, arbutin, salicin and esculin are also utilized.
- the strain was unable to utilize: ribose, lactose, galactose, melibiose, D-raffinose, glycogen, glycerol, erythritol, inositol, mannitol, sorbitol, xylitol, arabitol, gluconate and lactate.
- the strain was determined to be susceptible to ampicillin, chloramphenicol, erythromycin, fusidic acid, methicillin, novobiocin, streptomycin, tetracycline, sulphafurazole, oleandomycin, polymixin, rifampicin, vancomycin and bacitracin; but resistant to gentamicin, nitrofurantoin, nalidixic acid, sulphmethoxazole, trimethoprim, penicillin G, neomycin and kanamycin.
- the following enzymes aside from the protease of the present invention, were observed to be produced (ApiZym, API Coryne); C4-esterase, C8-esterase/lipase, leucine arylamidase, alpha-chymotrypsin, alpha-glucosidase, beta-glucosidase and pyrazinamidase.
- the strain was observed to exhibit the following chemotaxonomic characteristics.
- Major fatty acids were C16:1 (28.1%), C18:0 (31.1%), C18:1 (13.9%). N- saturated (79.1%), n-unsaturated (19.9%). Fatty acids with even numbers of carbons accounted for 98%.
- Main polar lipid components phosphatidylglycerol (PG) and 3 unidentified glycolipids (alpha-napthol positive) were present; DPG, PGP, PI and PE were not detected.
- Menaquinones MK-4, MK-6, MK-7 and MK-9 were the main isoprenoids present.
- the cell wall peptidoglycan type was A4 ⁇ with L-omithine as diamino acid and D- aspartic acid in the interpeptide bridge.
- toxicity evaluation there are no known toxicity or pathogenicity issues associated with bacteria of the genus Cellulomonas.
- enzymes of a specific type produced by organisms of the same species generally are substantially identical with respect to substrate specificity and/or proteolytic activity levels under given conditions (e.g., temperature, pH, water hardness, oxidative conditions, chelating conditions, and concentration), etc.
- the proteolytic polypeptides of this invention are characterized physicochemically, while in other embodiments, they are characterized based on their functionally, while in further embodiments, they are characterized using both sets of properties. Physicochemical characterization takes advantages of well known techniques such as SDS electrophoresis, gel filtration, amino acid composition, mass spectrometry (e.g,.
- the protease has a molecular weight of about 17kD to about 21 kD, for example about 18kD to 19kD, for example 18700 daltons to 18800 daltons, for example about 18764 daltons, as determined by MALDI-TOF-MS).
- the protease measured MALDI-TOF-MS spectrum as set forth in Figure 3.
- the mature protease also displays proteolytic activity (e.g., hydrolytic activity on a substrate having peptide linkages) such as DMC.
- proteases of the present invention provide enhanced wash performance under identified conditions.
- the proteases of the present invention exhibit at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% proteolytic activity as compared to the proteolytic activity of 69B4.
- the proteases display at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% proteolytic activity as compared to the proteolytic activity of proteases sold under the tradenames SAVINASE® (Novzymes) or PURAFECT® (Genencor) under the same conditions.
- the proteases of the present invention display comparative or enhanced wash performance under identified conditions as compared to 69B4 under the same conditions. In some preferred embodiments, the proteases of the present invention display comparative or enhanced wash performance under identified conditions, as compared to proteases sold under the tradenames SAVINASE® (Novozymes) or PURAFECT® (Genencor) under the same conditions. In yet further embodiments, the proteases and/or polynudeotides encoding the proteases of the present invention are provided purified form (i.e., present in a particular composition in a higher or lower concentration than exists in a naturally occurring or wild type organism), or in combination with components not normally present upon expression from a naturally occurring or wild-type organism. However, it is not intended that the present invention be limited to proteases of any specific purity level, as ranges of protease purity find use in various applications in which the proteases of the present inventing are suitable.
- nucleic acid encoding a protease of the present invention is obtained by standard procedures known in the art from, for example, cloned DNA (e.g., a DNA "library”), chemical synthesis, cDNA cloning, PCR, cloning of genomic DNA or fragments thereof, or purified from a desired cell, such as a bacterial or fungal species (See, for example, Sambrook et al., supra [1989]; and Glover and Hames (eds.), DNA Cloning: A Practical Approach, Vols 1 and 2, Second Edition).
- nucleic acid sequences derived from genomic DNA contain regulatory regions in addition to coding regions.
- DNA fragments are generated, some of which comprise at least a portion of the desired gene.
- the DNA is cleaved at specific sites using various restriction enzymes.
- DNAse is used in the presence of manganese to fragment the DNA, or the DNA is physically sheared (e.g., by sonication).
- the linear DNA fragments created are then be separated according to size and amplified by standard techniques, including but not limited to, agarose and polyacrylamide gel electrophoresis, PCR and column chromatography. Once nucleic acid fragments are generated, identification of the specific DNA fragment encoding a protease may be accomplished in a number of ways.
- a proteolytic hydrolyzing enzyme encoding the asp gene or its specific RNA, or a fragment thereof, such as a probe or primer is isolated, labeled, and then used in hybridization assays well known to those in the art, to detect a generated gene (See e.g., Benton and Davis, Science 196:180 [1977]; and Grunstein and Hogness, Proc. Natl. Acad. Sci. USA 72:3961 [1975]).
- DNA fragments sharing substantial sequence similarity to the probe hybridize under medium to high stringency.
- amplification is accomplished using PCR, as known in the art.
- a nucleic acid sequence of at least about 4 nucleotides and as many as about 60 nucleotides from SEQ ID NOS:1, 2, 3 and/or 4 i.e., fragments
- PCR primers preferably about 12 to 30 nucleotides, and more preferably about 25 nucleotides
- isolation of nucleic acid constructs of the invention from a cDNA or genomic library utilizes PCR with using degenerate oligonucleotide primers prepared on the basis of the amino acid sequence of the protein having the amino acid sequence as shown in SEQ ID NOS:1 -5.
- the primers can be of any segment length, for example at least 4, at least 5, at least 8, at least 15, at least 20, nucleotides in length.
- Exemplary probes in the present application utilized a primer comprising a TTGWHCGT and a GDSGG polynucleotide sequence as more fully described in Examples.
- the polynucleotide sequences provided herein and based on the polynucleotide sequences provided in SEQ ID NOS:1-5 are useful for obtaining identical or homologous fragments of polynudeotides from other species, and particularly from bacteria that encode enzymes having the serine protease activity expressed by protease 69B4.
- Numerous methods are also known in the art for introducing at least one (e.g., multiple) copies of the polynucleotide(s) encoding the enzyme(s) of the present invention in conjunction with any additional sequences desired, into the genes or genome of host cells.
- standard procedures for cloning of genes and introducing exogenous proteases encoding regions (including multiple copies of the exogenous encoding regions) into said genes find use in obtaining a Cellulomonas 69B4 protease derivative or homologue thereof.
- the present Specification including the Examples provides such teaching.
- additional methods known in the art are also suitable (See e.g., Sambrook etal.
- the polynucleotide sequences of the present invention are expressed by operatively linking them to an expression control sequence in an appropriate expression vector and employed by that expression vector to transform an appropriate host according to techniques well established in the art.
- the polypeptides produced on expression of the DNA sequences of this invention are isolated from the fermentation of cell cultures and purified in a variety of ways according to well established techniques in the art. Those of skill in the art are capable of selecting the most appropriate isolation and purification techniques.
- the present invention provides constructs, vectors comprising polynudeotides described herein, host cells transformed with such vectors, proteases expressed by such host cells, expression methods and systems for the production of serine protease enzymes derived from microorganisms, in particular, members of the Micrococcineae, including but not limited to Cellulomonas species.
- the polynucleotide(s) encoding serine protease(s) are used to produce recombinant host cells suitable for the expression of the serine protease(s).
- the expression hosts are capable of producing the protease(s) in commercially viable quantities.
- the present invention provides vectors comprising the aforementioned polynudeotides.
- the vectors (i.e., constructs) of the invention encoding the protease are of genomic origin (e.g., prepared though use of a genomic library and screening for DNA sequences coding for all or part of the protease by hybridization using synthetic oligonucleotide probes in accordance with standard techniques).
- the DNA sequence encoding the protease is obtained by isolating chromosomal DNA from the Cellulomonas strain 69B4 and amplifying the sequence by PCR methodology (See, the Examples).
- the nucleic acid construct of the invention encoding the protease is prepared synthetically by established standard methods (See e.g., Beaucage and Caruthers, Tetra. Lett. 22:1859-1869 [1981]; and Matthes etal., EMBO J., 3:801-805 [1984]). According to the phosphoramidite method, oligonucleotides are synthesized (e.g., in an automatic DNA synthesizer), purified, annealed, ligated and cloned in suitable vectors.. In additional embodiments, the nucleic acid construct is of mixed synthetic and genomic origin.
- the construct is prepared by ligating fragments of synthetic or genomic DNA (as appropriate), wherein the fragments correspond to various parts of the entire nucleic acid construct, in accordance with standard techniques.
- the present invention provides vectors comprising at least one DNA construct of the present invention.
- the present invention encompasses recombinant vectors. It is contemplated that any suitable vector will find use in the present invention, including autonomously replicating vector a well as vectors that integrate (either transiently or stably) within the host cell genome). Indeed, a wide variety of vectors, and expression cassettes suitable for the cloning, transformation and expression in fungal (mold and yeast), bacterial, insect and plant cells are known to those of skill in the art.
- the vector or cassette contains sequences directing transcription and translation of the nucleic acid, a selectable marker, and sequences allowing autonomous replication or chromosomal integration.
- suitable vectors comprise a region 5' of the gene which harbors transcriptional initiation controls and a region 3' of the DNA fragment which controls transcriptional termination. These control regions may be derived from genes homologous or heterologous to the host as long as the control region selected is able to function in the host cell.
- the vector is preferably an expression vector in which the DNA sequence encoding the protease of the invention is operably linked to additional segments required for transcription of the DNA.
- the expression vector is derived from plasmid or viral DNA, or in alternative embodiments, contains elements of both.
- Exemplary vectors include, but are not limited to pSEGCT, pSEACT, and/or pSEA4CT, as well as all of the vectors described in the Examples herein. Construction of such vectors is described herein, and methods are well known in the art (See e.g., U.S. Pat. No. 6,287,839; and WO 02/50245).
- the vector pSEGCT (about 8302 bp; See, Figure 5) finds use in the construction of a vector comprising the polynudeotides described herein (e.g., pSEG69B4T; See, Figure 6).
- the vector pSEA469B4CT finds use in the construction of a vector comprising the polynudeotides described herein. Indeed, it is intended that all of the vectors described herein will find use in the present invention.
- the additional segments required for transcription include regulatory segments (e.g., promoters, secretory segments, inhibitors, global regulators, etc.), as known in the art.
- regulatory segments e.g., promoters, secretory segments, inhibitors, global regulators, etc.
- One example includes any DNA sequence that shows transcriptional activity in the host cell of choice and is derived from genes encoding proteins either homologous or heterologous to the host cell.
- suitable promoters for use in bacterial host cells include but are not limited to the promoter of the Bacillus stearothermophilus maltogenic amylase gene, the Bacillus amyloliquefaciens (BAN) amylase gene, the Bacillus subtilis alkaline protease gene, the Bacillus clausii alkaline protease gene the Bacillus pumilus xylosidase gene, the Bacillus thuringiensis crylllA, and the Bacillus licheniformis alpha-amylase gene.
- Additional promoters include the A4 promoter, as described herein.
- the promoter is derived from a gene encoding said protease or a fragment thereof having substantially the same promoter activity as said sequence.
- the invention further encompasses nucleic acid sequences which hybridize to the promoter sequences under intermediate, high, and/or maximum stringency conditions, or which have at least about 90% homology and preferably about 95% homology to such promoter, but which have substantially the same promoter activity.
- this promoter is used to promote the expression of either the protease and/or a heterologous DNA sequence (e.g., another enzyme in addition to the protease of the present invention).
- the vector also comprises at least one selectable marker.
- the recombinant vectors of the invention further comprise a DNA sequence enabling the vector to replicate in the host cell. In some preferred embodiments involving bacterial host cells, these sequences comprise all the sequences needed to allow plasmid replication (e.g., o and/or rep sequences).
- signal sequences are also included in the vector, in order to direct a polypeptide of the present invention into the secretory pathway of the host cells.
- a secretory signal sequence is joined to the-DNA sequence encoding the precursor protease in the correct reading frame (See e.g., SEQ ID NOS:1 and 2).
- a polynucleotide sequence or expression vector of the invention is engineered with or without a.
- the signal peptide is a naturally occurring signal peptide, or a functional part thereof, while in other embodiments, it is a synthetic peptide.
- Suitable signal peptides include but are not limited to sequences derived from Bacillus licheniformis alpha-amylase, Bacillus clausii alkaline protease, and Bacillus amyloliquefaciens amylase.
- the signal peptide comprises the signal peptide from the protease described herein.
- This signal finds use in facilitating the secretion of the 69B4 protease and/or a heterologous DNA sequence (e.g. a second protease, such as another wild-type protease, a BPN' variant protease, a GG36 variant protease, a lipase, a cellulase, a mannanase, etc.).
- a heterologous DNA sequence e.g. a second protease, such as another wild-type protease, a BPN' variant protease, a GG36 variant protease, a lipase, a cellulase, a mannanase, etc.
- these second enzymes are encoded by the DNA sequence and/or the amino acid sequences known in the art (See e.g., U.S. Pat. Nos. 6,465,235, 6,287,839, 5,965,384, and 5,795,764; as well as WO 98/22500, WO 92/05249, EP 0305216B1 , and WO 94/25576).
- the signal sequence peptide is also be operatively linked to an endogenous sequence to activate and secrete such endogenous encoded protease.
- the procedures used to ligate the DNA sequences coding for the present protease, the promoter and/or secretory signal sequence, respectively, and to insert them into suitable vectors containing the information necessary for replication, are well known to those skilled in the art.
- the nucleic acid construct is prepared using PCR with specific primers.
- the present invention also provides host cells transformed with the vectors described above.
- the polynucleotide encoding the protease(s) of the present invention that is introduced into the host cell is homologous, while in other embodiments, the polynucleotide is heterologous to the host.
- the polynucleotide is homologous to the host cell (e.g., additional copies of the native protease produced by the host cell are introduced), it is operably connected to another homologous or heterologous promoter sequence.
- another secretory signal sequence, and/or terminator sequence find use in the present invention.
- the polypeptide DNA sequence comprises multiple copies of a homologous polypeptide sequence, a heterologous polypeptide sequence from another organism, or synthetic polypeptide sequence(s).
- the host cell into which the DNA construct of the present invention is introduced may be any cell which is capable of producing the present alkaline protease, including, but not limited to bacteria, fungi, and higher eukaryotic cells.
- bacterial host cells which find use in the present invention include, but are not limited to Gram-positive bacteria such as Bacillus, Streptomyces, and Thermobifida, for example strains of B. subtilis, B.
- the host cells are B. subtilis, B. clausii, and/or B. licheniformis.
- the host cells are strains of S. lividans (e.g., TK23 and/or TK21).
- Any suitable method for transformation of the bacteria find use in the present invention, including but not limited to protoplast transformation, use of competent cells, etc., as known in the art.
- the method provided in U.S. Pat. No. 5,264,366 finds used in the present invention.
- S. lividans one preferred means for transformation and protein expression is that described by Fernandez-Abalos et al.
- Example herein See, Fernandez-Abalos etal., Microbiol., 149:1623-1632 [2003]; See also, Hopwood, etal., Genetic Manipulation of Streptomyces: Laboratory Manual, Innis [1985], both of which are incorporated by reference herein).
- fungal host cells which find use in the present invention include, but are not limited to Trichoderma spp. and Aspergillus spp.
- the host cells are Trichoderma reesei and/or Aspergillus niger.
- transformation and expression in Aspergillus is performed as described in U.S. Pat.
- the methods described in the Example herein find use in the present invention.
- particular promoter and signal sequences are needed to provide effective transformation and expression of the protease(s) of the present invention.
- the aprE promoter is used in combination with known Bacillus- ⁇ e rived signal and other regulatory sequences.
- the glaA promoter is used.
- the glucose isomerase (Gl) promoter of Actinoplanes missouriensis is used, while in other embodiments, the A4 promoter is used.
- the protease is retained in the cytoplasm, typically as insoluble granules (i.e., inclusion bodies).
- the protease is directed to the periplasmic space by a bacterial secretion sequence.
- the cells are lysed, and the granules are recovered and denatured after which the protease is refolded by diluting the denaturing agent.
- the protease is recovered from the periplasmic space by disrupting the cells (e.g., by sonication or osmotic shock), to release the contents of the periplasmic space and recovering the protease.
- the transformed host cells of the present invention are cultured in a suitable nutrient medium under conditions permitting the expression of the present protease, after which the resulting protease is recovered from the culture.
- the medium used to culture the cells comprises any conventional medium suitable for growing the host cells, such as minimal or complex media containing appropriate supplements. Suitable media are available from commercial suppliers or may be prepared according to published recipes (e.g., in catalogues of the American Type Culture Collection).
- the protease produced by the cells is recovered from the culture medium by conventional procedures, including, but not limited to separating the host cells from the medium by centrifugation or filtration, precipitating the proteinaceous components of the supernatant or filtrate by means of a salt (e.g., ammonium sulfate), chromatographic purification (e.g., ion exchange, gel filtration, affinity, etc.).
- a salt e.g., ammonium sulfate
- chromatographic purification e.g., ion exchange, gel filtration, affinity, etc.
- the proteases of the present invention have important characteristics that make them very suitable for certain applications.
- the proteases of the present invention have enhanced thermal stability, enhanced oxidative stability, and enhanced chelator stability, as compared to some currently used proteases.
- these proteases find use in cleaning compositions.
- the present proteases exhibit comparative or enhanced wash performance as compared with currently used subtilisin proteases.
- the cleaning and/or enzyme compositions of the present invention will be provided in a variety of cleaning compositions.
- the proteases of the present invention are utilized in the same manner as subtilisin proteases (i.e., proteases currently in use).
- subtilisin proteases i.e., proteases currently in use.
- the present proteases find use in various cleaning compositions, as well as animal feed applications, leather processing (e.g., bating), protein hydrolysis, and in textile uses.
- the identified proteases also find use in personal care applications. .
- the proteases of the present invention find use in a number of industrial applications, in particular within the cleaning, disinfecting, animal feed, and textile/leather industries.
- the protease(s) of the present invention are combined with detergents, builders, bleaching agents and other conventional ingredients to produce a variety of novel cleaning compositions useful in the laundry and other cleaning arts such as, for example, laundry detergents (both powdered and liquid), laundry pre-soaks, all fabric bleaches, automatic dishwashing detergents (both liquid and powdered), household cleaners, particularly bar and liquid soap applications, and drain openers.
- laundry detergents both powdered and liquid
- laundry pre-soaks all fabric bleaches
- automatic dishwashing detergents both liquid and powdered
- household cleaners particularly bar and liquid soap applications
- drain openers a variety of novel cleaning compositions useful in the laundry and other cleaning arts
- the protease find use in the cleaning of contact lenses, as well as other items, by contacting such materials with an aqueous solution of the cleaning composition.
- these naturally occurring proteases can be used, for example in peptide hydrolysis, waste treatment, textile applications, medical device cleaning, biofilm removal and as fusion- cleavage enzymes in protein production, etc.
- the composition of these products is not critical to the present invention, as long as the protease(s) maintain their function in the setting used.
- the compositions are readily prepared by combining a cleaning effective amount of the protease or an enzyme composition comprising the protease enzyme preparation with the conventional components of such compositions in their art recognized amounts.
- the cleaning composition of the present invention may be advantageously employed for example, in laundry applications, hard surface cleaning, automatic dishwashing applications, as well as cosmetic applications such as dentures, teeth, hair and skin.
- the enzymes of the present invention are ideally suited for laundry applications such as the bleaching of fabrics.
- the enzymes of the present invention may be employed in both granular and liquid compositions.
- the enzymes of the present invention may also be employed in a cleaning additive product.
- a cleaning additive product including the enzymes of the present invention is ideally suited for inclusion in a wash process when additional bleaching effectiveness is desired. Such instances may include, but are not limited to low temperature solution cleaning application.
- the additive product may be, in its simplest form, one or more proteases, including ASP.
- Such additive may be packaged in dosage form for addition to a cleaning process where a source of peroxygen is employed and increased bleaching effectiveness is desired.
- Such single dosage form may comprise a pill, tablet, gelcap or other single dosage unit such as pre-measured powders or liquids.
- a filler or carrier material may be included to increase the volume of such composition. Suitable filler or carrier materials include, but are not limited to, various salts of sulfate, carbonate and silicate as well as talc, clay and the like.
- Filler or carrier materials for liquid compositions may be water or low molecular weight primary and secondary alcohols including polyols and diols.
- Such alcohols include, but are not limited to, methanol, ethanol, propanol and isopropanol.
- the compositions may contain from about 5% to about 90% of such materials.
- Acidic fillers can be used to reduce pH.
- the cleaning additive may include activated peroxygen source defined below or the adjunct ingredients as fully defined below.
- the present cleaning compositions and cleaning additives require an effective amount of the ASP enzyme and/or variants provided herein. The required level of enzyme may be achieved by the addition of one or more species of the enzymes of the present invention.
- the present cleaning compositions will comprise at least 0.0001 weight percent, from about 0.0001 to about 1 , from about 0.001 to about 0.5, or even from about 0.01 to about 0.1 weight percent of at least one of the enzymes of the present invention.
- the cleaning compositions herein will typically be formulated such that, during use in aqueous cleaning operations, the wash water will have a pH of from about 5.0 to about 11.5 or even from about 7.5 to about 10.5.
- Liquid product formulations are typically formulated to have a neat pH from about 3.0 to about 9.0 or even from about 3 to about 5.
- Granular laundry products are typically formulated to have a pH from about 9 to about 11.
- Suitable low pH cleaning compositions typically have a neat pH of from about 3 to about 5, and are typically free of surfactants that hydrolyze in such a pH environment.
- surfactants include sodium alkyl sulfate surfactants that comprise at least one ethylene oxide moiety or even from about 1 to 16 moles of ethylene oxide.
- Such cleaning compositions typically comprise a sufficient amount of a pH modifier, such as sodium hydroxide, monoethanolamine or hydrochloric acid, to provide such cleaning composition with a neat pH of from about 3 to about 5.
- Such compositions typically comprise at least one acid stable enzyme. Said compositions may be liquids or solids.
- the pH of such liquid compositions is measured as a neat pH.
- the pH of such solid compositions is measured as a 10% solids solution of said composition wherein the solvent is distilled water. In these embodiments, all pH measurements are taken at 20°C.
- the enzyme may be desirable for the enzyme to be in the form of an encapsulated particle to protect such enzyme from other components of the granular composition during storage.
- encapsulation is also a means of controlling the availability of the enzyme during the cleaning process and may enhance performance of the enzymes provided herein.
- the serine proteases of the present invention may be encapsulated with any encapsulating material known in the art.
- the encapsulating material typically encapsulates at least part of the catalyst for the enzymes of the present invention.
- the encapsulating material is water-soluble and/or water-dispersible.
- the encapsulating material may have a glass transition temperature (Tg) of 0°C or higher. Glass transition temperature is described in more detail in WO 97/11151, especially from page 6, line 25 to page 7, line 2.
- the encapsulating material is may be selected from the group consisting of carbohydrates, natural or synthetic gums, chitin and chitosan, cellulose and cellulose derivatives, silicates, phosphates, borates, polyvinyl alcohol, polyethylene glycol, paraffin waxes and combinations thereof.
- the encapsulating material when the encapsulating material is a carbohydrate, it may be typically selected from the group consisting of monosaccharides, oligosaccharides, polysaccharides, and combinations thereof.
- the encapsulating material is a starch. Suitable starches are described in EP 0 922 499; US 4,977,252; US 5,354,559 and US 5,935,826.
- the encapsulating material may be a microsphere made from plastic such as thermoplastics, acrylonitrile, methacrylonitrile, polyacrylonitrile, polymethacrylonitrile and mixtures thereof; commercially available microspheres that can be used are those supplied by Expancel of Stockviksverken, Sweden under the trademark Expancel®, and those supplied by PQ Corp. of Valley Forge, Pennsylvania U.S.A. under the tradename PM 6545, PM 6550, PM 7220, PM 7228, Extendospheres®, Luxsil®, Q-cel® and Sphericel®.
- the proteases of the present invention find particular use in the cleaning industry, including, but not limited to laundry and dish detergents.
- proteases of the present invention provide advantages over many currently used enzymes, due to their stability under various conditions. Indeed, there are a variety of wash conditions including varying detergent formulations, wash water volumes, wash water temperatures, and lengths of wash time, to which proteases involved in washing are exposed.
- detergent formulations used in different geographical areas have different concentrations of their relevant components present in the wash water. For example, a European detergent typically has about 4500- 5000 ppm of detergent components in the wash water, while a Japanese detergent typically has approximately 667 ppm of detergent components in the wash water. In North America, particularly the United States, detergents typically have about 975 ppm of detergent components present in the wash water.
- a low detergent concentration system includes detergents where less than about 800 ppm of detergent components are present in the wash water.
- Japanese detergents are typically considered low detergent concentration system as they have approximately 667 ppm of detergent components present in the wash water.
- a medium detergent concentration includes detergents where between about 800 ppm and about 2000ppm of detergent components are present in the wash water.
- North American detergents are generally considered to be medium detergent concentration systems as they have approximately 975 ppm of detergent components present in the wash water. Brazil typically has approximately 1500 ppm of detergent components present in the wash water.
- a high detergent concentration system includes detergents where greater than about 2000 ppm of detergent components are present in the wash water.
- European detergents are generally considered to be high detergent concentration systems as they have approximately 4500-5000 ppm of detergent components in the wash water.
- Latin American detergents are generally high suds phosphate builder detergents and the range of detergents used in Latin America can fall in both the medium and high detergent concentrations as they range from 1500 ppm to 6000 ppm of detergent components in the wash water. As mentioned above, Brazil typically has approximately 1500 ppm of detergent components present in the wash water. However, other high suds phosphate builder detergent geographies, not limited to other Latin American countries, may have high detergent concentration systems up to about 6000 ppm of detergent components present in the wash water.
- concentrations of detergent compositions in typical wash solutions throughout the world varies from less than about 800 ppm of detergent composition ("low detergent concentration geographies"), for example about 667 ppm in Japan, to between about 800 ppm to about 2000 ppm ("medium detergent concentration geographies” ), for example about 975 ppm in U.S. and about 1500 ppm in Brazil, to greater than about 2000 ppm ("high detergent concentration geographies”), for example about 4500 ppm to about 5000 ppm in Europe and about 6000 ppm in high suds phosphate builder geographies.
- concentrations of the typical wash solutions are determined empirically.
- a typical washing machine holds a volume of about 64.4 L of wash solution. Accordingly, in order to obtain a concentration of about 975 ppm of detergent within the wash solution about 62.79 g of detergent composition must be added to the 64.4 L of wash solution. This amount is the typical amount measured into the wash water by the consumer using the measuring cup provided with the detergent.
- different geographies use different wash temperatures. The temperature of the wash water in Japan is typically less than that used in Europe. For example, the temperature of the wash water in North America and Japan can be between 10 and 30°C (e.g., about 20°C), whereas the temperature of wash water in Europe is typically between 30 and 60°C (e.g., about 40 ° C).
- Water hardness is usually described in terms of the grains per gallon mixed Ca 2+ /Mg 2+ ; Hardness is a measure of the amount of calcium (Ca 2+ ) and magnesium (Mg 2+ ) in the water. Most water in the United States is hard, but the degree of hardness varies. Moderately hard (60-120 ppm) to hard (121-181 ppm) water has 60 to 181 parts per million (parts per million converted to grains per U.S. gallon is ppm # divided by 17.1 equals grains per gallon) of hardness minerals.
- European water hardness is typically greater than 10.5 (for example 10.5-20.0) grains per gallon mixed Ca 2+ /Mg 2+ (e.g., about 15 grains per gallon mixed Ca 2+ /Mg 2+ ).
- North American water hardness is typically greater than Japanese water hardness, but less than European water hardness.
- North American water hardness can be between 3 to10 grains, 3-8 grains or about 6 grains.
- Japanese water hardness is typically lower than North American water hardness, usually less than 4, for example 3 grains per gallon mixed Ca 2+ /Mg 2+ .
- the present invention provides proteases that show surprising wash performance in at least one set of wash conditions (e.g., water temperature, water hardness, and/or detergent concentration).
- the proteases of the present invention are comparable in wash performance to subtilisin proteases. In some embodiments, the proteases of the present invention exhibit enhanced wash performance as compared to subtilisin proteases. Thus, in some preferred embodiments of the present invention, the proteases provided herein exhibit enhanced oxidative stability, enhanced thermal stability, and/or enhanced chelator stability. In some preferred embodiments, the present invention provides the ASP protease, as well as homologues and variants fo the protease. These proteases find use in any applications in which it is desired to clean protein based stains from textiles or fabrics.
- the cleaning compositions of the present invention are formulated as hand and machine laundry detergent compositions including laundry additive compositions, and compositions suitable for use in the pretreatment of stained fabrics, rinse- added fabric softener compositions, and compositions for use in general household hard surface cleaning operations, as well as dishwashing operations.
- the proteases of the present invention comprise comparative or enhanced performance in detergent compositions (i.e., as compared to other proteases).
- cleaning performance is evaluated by comparing the proteases of the present invention with subtilisin proteases in various cleaning assays that utilize enzyme- sensitive stains such as egg, grass, blood, milk, etc., in standard methods.
- proteases of the invention to conventional cleaning compositions does not create any special use limitation.
- any temperature and pH suitable for the detergent is also suitable for the present compositions, as long as the pH is within the range set forth herein, and the temperature is below the described protease's denaturing temperature.
- proteases of the present invention find use in cleaning compositions that do not include detergents, again either alone or in combination with builders and stabilizers. When used in cleaning compositions or detergents, oxidative stability is a further consideration.
- the stability is enhanced, diminished, or comparable to subtilisin proteases as desired for various uses.
- enhanced oxidative stability is desired.
- Some of the proteases of the present invention find particular use in such applications.
- thermal stability is a further consideration.
- the stability is enhanced, diminished, or comparable to subtilisin proteases as desired for various uses.
- enhanced thermostability is desired.
- Some of the proteases of the present invention find particular use in such applications.
- chelator stability is a further consideration.
- the stability is enhanced, diminished, or comparable to subtilisin proteases as desired for various uses.
- enhanced chelator stability is desired.
- a pH-activity profile is a plot of pH against enzyme activity and may be constructed as described in the Examples and/or by methods known in the art.
- it is desired to obtain naturally occurring proteases with broader profiles i.e., those having greater activity at range of pHs than a comparable subtilisin protease.
- the enzymes have no significantly greater activity at any pH, or naturally occurring homologues with sharper profiles (i.e., those having enhanced activity when compared to subtilisin proteases at a given pH, and lesser activity elsewhere).
- the proteases of the present invention have differing pH optima and/or ranges.
- the cleaning compositions comprise, proteases of the present invention at a level from 0.00001 % to 10% of 69B4 and/or other protease of the present invention by weight of the composition and the balance (e.g., 99.999% to 90.0%) comprising cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present invention comprise, the 69B4 and/or other proteases at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001% to 2%, 0.005% to 0.5% 69B4 or other protease of the present invention by weight of the composition and the balance of the cleaning composition (e.g., 99.9999% to 90.0%, 99.999 % to 98%, 99.995% to 99.5% by weight) comprising cleaning adjunct materials.5
- preferred cleaning compositions in addition to the protease preparation of the invention, comprise one or more additional enzymes or enzyme derivatives which provide cleaning performance and/or fabric care benefits.
- Such enzymes include, but are not limited to other proteases, lipases, cutinases, amylases, cellulases, peroxidases, oxidases (e.g. laccases), and/or mannanases.o Any other protease suitable for use in alkaline solutions finds use in the compositions of the present invention. Suitable proteases include those of animal, vegetable or microbial origin. In particularly preferred embodiments, microbial proteases are used. In some embodiments, chemically or genetically modified mutants are included. In some embodiments, the protease is a serine protease, preferably an alkaline microbial protease or5 a trypsin-like protease.
- alkaline proteases examples include subtilisins, especially those derived from Bacillus (e.g., subtilisin, lentus, amyloliquefaciens, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168). Additional examples include those mutant proteases described in U.S. Pat. Nos. RE 34,606, 5,955,340, 5,700,676, 6,312,936, and 6,482,628, all of which are incorporated herein by reference. Additional protease examples include, but are not limited to trypsin (e.g., of porcine or bovine origin), and the Fusarium protease described in WO 89/06270.
- subtilisins especially those derived from Bacillus (e.g., subtilisin, lentus, amyloliquefaciens, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168). Additional examples include those mutant proteases described in U.S.
- Preferred commercially available protease enzymes include those sold under the trade names MAXATASE®, MAXACALTM, MAXAPEMTM, OPTICLEAN®, OPTIMASE®, PROPERASE®, PURAFECT® and PURAFECT® OXP (Genencor), those sold under the trade names ALCALASE®, SAVINASE®, PRIMASE®, DURAZYMTM, RELASE® and ESPERASE® (Novozymes); and those sold under the trade name BLAPTM (Henkel Kilandit GmbH auf Aktien, Duesseldorf , Germany.
- Various proteases are described in WO95/23221 , WO 92/21760, and U.S. Pat. Nos.
- the cleaning compositions of the present invention comprise additional protease enzymes at a level from 0.00001 % to 10% of additional protease by weight of the composition and 99.999% to 90.0% of cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present invention also comprise, proteases at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001% to 2%, 0.005% to 0.5% 69B4 protease (or its homologues or variants) by weight of the composition and the balance of the cleaning composition (e.g., 99.9999% to 90.0%, 99.999 % to 98%, 99.995% to 99.5% by weight) comprising cleaning adjunct materials.
- any lipase suitable for use in alkaline solutions finds use in the present invention.
- Suitable lipases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are encompassed by the present invention.
- useful lipases include Humicola lanuginosa lipase (See e.g., EP 258 068, and EP 305 216), Rhizomucor miehei lipase (See e.g., EP 238 023), Candida lipase, such as C. antarctica lipase (e.g., the C.
- antarctica lipase A or B See e.g., EP 214 761), a Pseudomonas lipase such as P. alcaligenes and P. pseudoalcaligenes lipase (See e.g., EP 218272), P. cepacia lipase (See e.g., EP 331 376), P. stutzeri lipase (See e.g., GB 1 ,372,034), P. fluorescens lipase, Bacillus lipase (e.g., B. subtilis lipase [Dartois etal., Biochem. Biophys. Acta 1131 :253-260 [1993]); B.
- Pseudomonas lipase such as P. alcaligenes and P. pseudoalcaligenes lipase (See e.g., EP 218272), P. cepacia lipase (See e
- stearothermophilus lipase See e.g., JP 64/744992]; and B. pumilus lipase [See e.g., WO 91/16422]).
- a number of cloned lipases find use in some embodiments of the present invention, including but not limited to Penicillium camembertii lipase (See, Yamaguchi et al., Gene 103:61-67 [1991]), Geotricum candidum lipase (See, Schimada et al., J. Biochem., 106:383-388 [1989]), and various Rhizopus lipases such as R.
- delemar lipase See, Hass etal., Gene 109:117-113 [1991]
- a R. niveus lipase Kugimiya era/., Biosci. Biotech. Biochem. 56:716-719 [1992]
- R. oryzae lipase Other types of lipolytic enzymes such as cutinases also find use in some embodiments of the present invention, including but not limited to the cutinase derived from Pseudomonas mendocina (See, WO 88/09367), or cutinase derived from Fusarium solani pisi (See, WO 90/09446).
- the cleaning compositions of the present invention further comprise lipases at a level from 0.00001 % to 10% of additional lipase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present invention also comprise, lipases at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001 % to 2%, 0.005% to 0.5% lipase by weight of the composition.
- Any amylase (alpha and/or beta) suitable for use in alkaline solutions also find use in some embodiments of the present invention. Suitable amylases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments.
- Amylases that find use in the present invention include, but are not limited to ⁇ -amylases obtained from B. licheniformis (See e.g., GB 1 ,296,839).
- the cleaning compositions of the present invention further comprise amylases at a level from 0.00001 % to 10% of additional amylase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present invention also comprise, amylases at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001% to 2%, 0.005% to 0.5% amylase by weight of the composition.
- amylases at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001% to 2%, 0.005% to 0.5% amylase by weight of the composition.
- Any cellulase suitable for use in alkaline solutions find use in embodiments of the present invention.
- Suitable cellulases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments.
- Suitable cellulases include, but are not limited to Humicola insolens cellulases (See e.g., U.S. Pat. No. 4,435,307).
- cellulases having color care benefits (See e.g., EP 0495 257).
- Commercially available cellulases that find use in the present include, but are not limited to CELLUZYME® (Novozymes), and KAC-500(B)TM (Kao Corporation).
- cellulases are incorporated as portions or fragments of mature wild-type or variant cellulases, wherein a portion of the N-terminus is deleted (See e.g., U.S. Pat. No. 5,874,276).
- the cleaning compositions of the present invention can further comprise cellulases at a level from 0.00001 % to 10% of additional cellulase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present invention also comprise cellulases at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001 % to 2%, 0.005% to 0.5% cellulase by weight of the composition.
- Any mannanase suitable for use in detergent compositions and or alkaline solutions find use in the present invention. Suitable mannanases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments.
- the cleaning compositions of the present invention can further comprise mannanases at a level from 0.00001 % to 10% of additional mannanase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present invention also comprise, mannanases at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001% to 2%, 0.005% to 0.5% mannanase by weight of the composition.
- peroxidases are used in combination with hydrogen peroxide or a source thereof (e.g., a percarbonate, perborate or persulfate).
- oxidases are used in combination with oxygen.
- Both types of enzymes are used for "solution bleaching" (i.e., to prevent transfer of a textile dye from a dyed fabric to another fabric when the fabrics are washed together in a wash liquor), preferably together with an enhancing agent (See e.g., WO 94/12621 and WO 95/01426).
- Suitable peroxidases/oxidases include, but are not limited to those of plant, bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments.
- the cleaning compositions of the present invention can further comprise peroxidase and/or oxidase enzymes at a level from 0.00001 % to 10% of additional peroxidase and/or oxidase by weight of the composition and the balance of cleaning adjunct materials by weight of composition.
- the cleaning compositions of the present invention also comprise, peroxidase and/or oxidase enzymes at a level of 0.0001 % to 10%, 0.001% to 5%, 0.001% to 2%, 0.005% to 0.5% peroxidase and/or oxidase enzymes by weight of the composition.
- mixtures of the above mentioned enzymes are encompassed herein, in particular a mixture of a the 69B4 enzyme, one or more additional proteases, at least one amylase, at least one lipase, at least one mannanase, and/or at least one cellulase. Indeed, it is contemplated that various mixtures of these enzymes will find use in the present invention. It is contemplated that the varying levels of the protease and one or more additional enzymes may , both independently range to 10%, the balance of the cleaning composition being cleaning adjunct materials. The specific selection of cleaning adjunct materials are readily made by considering the surface, item, or fabric to be cleaned, and the desired form of the composition for the cleaning conditions during use (e.g., through the wash detergent use).
- cleaning adjunct materials include, but are not limited to, surfactants, builders, bleaches, bleach activators, bleach catalysts, other enzymes, enzyme stabilizing systems, chelants, optical brighteners, soil release polymers, dye transfer agents, dispersants, suds suppressors, dyes, perfumes, colorants, filler salts, hydrotropes, photoactivators, fluorescers, fabric conditioners, hydrolyzable surfactants, preservatives, anti-oxidants, anti-shrinkage agents, anti-wrinkle agents, germicides, fungicides, color speckles, silvercare, anti-tarnish and/or anti-corrosion agents, alkalinity sources, solubilizing agents, carriers, processing aids, pigments, and pH control agents (See e.g., U.S.
- an effective amount of one or more protease(s) provided herein are included in compositions useful for cleaning a variety of surfaces in need of proteinaceous stain removal.
- cleaning compositions include cleaning compositions for such applications as cleaning hard surfaces, fabrics, and dishes.
- the present invention provides fabric cleaning compositions, while in other embodiments, the present invention provides non-fabric cleaning compositions.
- the present invention also provides cleaning compositions suitable for personal care, including oral care (including dentrifices, toothpastes, mouthwashes, etc., as well as denture cleaning compositions), skin, and hair cleaning compositions.
- the present invention encompass detergent compositions in any form (i.e., liquid, granular, bar, semi-solid, gels, emulsions, tablets, capsules, etc.).
- detergent compositions in any form (i.e., liquid, granular, bar, semi-solid, gels, emulsions, tablets, capsules, etc.).
- the cleaning compositions of the present invention are formulated as compositions suitable for use in laundry machine washing method(s)
- the compositions of the present invention preferably contain at least one surfactant and at least one builder compound, as well as one or more cleaning adjunct materials preferably selected from organic polymeric compounds, bleaching agents, additional enzymes, suds suppressors, dispersants, lime-soap dispersants, soil suspension and anti-redeposition agents and corrosion inhibitors.
- laundry compositions also contain softening agents (i.e., as additional cleaning adjunct materials).
- the compositions of the present invention also find use detergent additive products in solid or liquid form. Such additive products are intended to supplement and/or boost the performance of conventional detergent compositions and can be added at any stage of the cleaning process.
- the compositions of the invention preferably contain at least one surfactant and preferably at least one additional cleaning adjunct material selected from organic polymeric compounds, suds enhancing agents, group II metal ions, solvents, hydrotropes and additional enzymes.
- the density of the laundry detergent compositions herein ranges from 400 to 1200 g/liter, while in other embodiments, it ranges from 500 to 950 g/liter of composition measured at 20°C.
- various cleaning compositions such as those provided in U.S, Pat. No. 6,605,458 find use with the proteases of the present invention.
- the compositions comprising at least one protease of the present invention is a compact granular fabric cleaning composition, while in other embodiments, the composition is a granular fabric cleaning composition useful in the laundering of colored fabrics, in further embodiments, the composition is a granular fabric cleaning composition which provides softening through the wash capacity, in additional embodiments, the composition is a heavy duty liquid fabric cleaning composition.
- the compositions comprising at least one protease of the present invention are fabric cleaning compositions such as those described in U.S. Pat. Nos. 6,610,642 and 6,376,450.
- the proteases of the present invention find use in granular laundry detergent compositions of particular utility under European or Japanese washing conditions (See e.g., U.S. Pat. No. 6,610,642).
- the present invention provides hard surface cleaning compositions comprising at least one protease provided herein.
- the compositions comprising at least one protease of the present invention is a hard surface cleaning composition such as those described in U.S. Pat. Nos. 6,610,642, 6,376,450, and 6,376,450.
- the present invention provides dishwashing compositions comprising at least one protease provided herein.
- the compositions comprising at least one protease of the present invention is a hard surface cleaning composition such as those in U.S. Pat. Nos. 6,610,642 and 6,376,450.
- the present invention provides dishwashing compositions comprising at least one protease provided herein.
- the compositions comprising at least one protease of the present invention comprise oral care compositions such as those in U.S. Pat. No. 6,376,450, and 6,376,450.
- the cleaning compositions of the present invention can be formulated into any suitable form and prepared by any process chosen by the formulator, non-limiting examples of which are described in U.S. Pat. Nos. 5,879,584, 5,691,297, 5,574,005, 5,569,645, 5,565,422, 5,516,448, 5,489,392, and 5,486,303, all of which are incorporated herein by reference.
- the pH of such composition may be adjusted via the addition of a material such as monoethanolamine or an acidic material such as HCI.
- adjuncts Adjunct Materials In Addition to the Serine Proteases of the Present Invention
- the non-limiting list of adjuncts illustrated hereinafter are suitable for use in the instant cleaning compositions and may be desirably incorporated in certain embodiments of the invention, for example to assist or enhance cleaning performance, for treatment of the substrate to be cleaned, or to modify the aesthetics of the cleaning composition as is the case with perfumes, colorants, dyes or the like. It is understood that such adjuncts are in addition to the serine proteases of the present invention. The precise nature of these additional components, and levels of incorporation thereof, will depend on the physical form of the composition and the nature of the cleaning operation for which it is to be. used.
- Suitable adjunct materials include, but are not limited to, surfactants, builders, chelating agents, dye transfer inhibiting agents, deposition aids, dispersants, additional enzymes, and enzyme stabilizers, catalytic materials, bleach activators, bleach boosters, hydrogen peroxide, sources of hydrogen. peroxide, preformed peracids, polymeric dispersing agents, clay soil removal/anti-redeposition agents, brighteners, suds suppressors, dyes, perfumes, structure elasticizing agents, fabric softeners, carriers, hydrotropes, processing aids and/or pigments.
- suitable examples of such other adjuncts and levels of use are found in U.S. Patent Nos.
- the cleaning compositions according to the present invention may comprise a surfactant or surfactant system wherein the surfactant can be selected from nonionic surfactants, anionic surfactants, cationic surfactants, ampholytic surfactants, zwitte onic surfactants, semi-polar nonionic surfactants and mixtures thereof.
- a low pH cleaning composition such as composition having a neat pH of from about 3 to about 5
- such composition typically does not contain alkyl ethoxylated sulfate as it is believed that such surfactant may be hydrolyzed by such compositions the acidic contents.
- the surfactant is typically present at a level of from about 0.1% to about 60%, from about 1 % to about 50% or even from about 5% to about 40% by weight of the subject cleaning composition.
- Builders - The cleaning compositions of the present invention may comprise one or more detergent builders or builder systems. When a builder is used, the subject cleaning composition will typically comprise at least about 1%, from about 3% to about 60% or even from about 5% to about 40% builder by weight of the subject cleaning composition.
- Builders include, but are not limited to, the alkali metal, ammonium and alkanolammonium salts of polyphosphates, alkali metal silicates, alkaline earth and alkali metal carbonates, aluminosilicate builders polycarboxylate compounds, ether hydroxypolycarboxylates, copolymers of maleic anhydride with ethylene or vinyl methyl ether, 1, 3, 5-trihydroxy benzene-2, 4, 6-thsulphonic acid, and carboxymethyloxysuccinic acid, the various alkali metal, ammonium and substituted ammonium salts of polyacetic acids such as ethylenediamine tetraacetic acid and nitrilotriacetic acid, as well as polycarboxylat.es such as mellitic acid, succinic acid, citric acid, oxydisuccinic acid, polymaleic acid, benzene 1,3,5-tricarboxylic acid, carboxymethyloxysuccinic acid, and soluble salts
- the cleaning compositions herein may contain a chelating agent, Suitable chelating agents include copper, iron and/or manganese chelating agents and mixtures thereof. When a chelating agent is used, the cleaning composition may comprise from about 0.1% to about 15% or even from about 3.0% to about 10% chelating agent by weight of the subject cleaning composition.
- Deposition Aid - The cleaning compositions herein may contain a deposition aid. Suitable deposition aids include, polyethylene glycol, polypropylene glycol, polycarboxylate, soil release polymers such as polytelephthalic acid, clays such as Kaolinite, montmorillonite, atapulgite, illite, bentonite, halloysite, and mixtures thereof.
- the cleaning compositions of the present invention may also include one or more dye transfer inhibiting agents.
- Suitable polymeric dye transfer inhibiting agents include, but are not limited to, polyvinylpyrrolidone polymers, polyamine N- oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof.
- the dye transfer inhibiting agents may be present at levels from about 0.0001% to about 10%, from about 0.01% to about 5% or even from about 0.1 % to about 3% by weight of the cleaning composition.
- Dispersants The cleaning compositions of the present invention can also contain dispersants.
- Suitable water-soluble organic materials include the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated from each other by not more than two carbon atoms.
- Enzymes - The cleaning compositions can comprise one or more detergent enzymes which provide cleaning performance and/or fabric care benefits.
- suitable enzymes include, but are not limited to, hemicellulases, peroxidases, proteases, cellulases, xylanases, lipases, phospholipases, esterases, cutinases, pectinases, keratinases, reductases, oxidases, phenol oxidases, lipoxygenases, ligninases, pullulanases, tannases, pentosanases, malanases, ⁇ -glucanases, arabinosidases, hyaluronidase, chondroitinase, laccase, and amylases, or mixtures thereof.
- a typical combination is cocktail of conventional applicable enzymes like protease, lipase, cutinase and/or cellulase in conjunction with amylase.
- Enzyme Stabilizers Enzymes for use in detergents can be stabilized by various techniques.
- the enzymes employed herein can be stabilized by the presence of water- soluble sources of calcium and/or magnesium ions in the finished compositions that provide such ions to the enzymes.
- Catalytic Metal Complexes The cleaning compositions of the present invention may include catalytic metal complexes.
- One type of metal-containing bleach catalyst is a catalyst system comprising a transition metal cation of defined bleach catalytic activity, such as copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations, an auxiliary metal cation having little or no bleach catalytic activity, such as zinc or aluminum cations, and a sequestrate having defined stability constants for the catalytic and auxiliary metal cations, particularly ethylenediaminetetraacetic acid, ethylenediaminetetra (methylenephosphonic acid) and water-soluble salts thereof.
- a transition metal cation of defined bleach catalytic activity such as copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations
- an auxiliary metal cation having little or no bleach catalytic activity such as zinc or aluminum cations
- a sequestrate having defined stability constants for the catalytic and auxiliary metal cations, particularly ethylenediaminetetraace
- compositions herein may also suitably include a transition metal complex of a macropolycyclic rigid ligand - abbreviated as "MRL".
- compositions and cleaning processes herein can be adjusted to provide on the order of at least one part per hundred million of the active MRL species in the aqueous washing medium, and will preferably provide from about 0.005 ppm to about 25 ppm, more preferably from about 0.05 ppm to about 10 ppm, and most preferably from about 0.1 ppm to about 5 ppm, of the MRL in the wash liquor.
- Preferred transition-metals in the instant transition-metal bleach catalyst include manganese, iron and chromium.
- Preferred MRUs herein are a special type of ultra-rigid ligand that is cross-bridged such as 5,12-diethyl-1 ,5,8,12-tetraazabicyclo[6.6.2]hexadecane.
- Suitable transition metal MRLs are readily prepared by known procedures, such as taught for example in WO 00/332601 , and U.S. Pat. No. 6,225,464.
- the cleaning compositions of the present invention can be formulated into any suitable form and prepared by any process chosen by the formulator, non-limiting examples of which are described in U.S. Pat. Nos. 5,879,584, 5,691,297, 5,574,005, 5,569,645, 5,516,448, 5,489,392, and 5,486,303, all of which are incorporated herein by reference.
- the cleaning compositions disclosed herein of can be used to clean a situs inter alia a surface or fabric. Typically at least a portion of the situs is contacted with an embodiment of the present cleaning composition, in neat form or diluted in a wash liquor, and then the situs is optionally washed and/or rinsed. For purposes of the present invention, washing includes but is not limited to, scrubbing, and mechanical agitation.
- the fabric may comprise most any fabric capable of being laundered in normal consumer use conditions.
- the disclosed cleaning compositions are typically employed at concentrations of from about 500 ppm to about 15,000 ppm in solution. When the wash solvent is water, the water temperature typically ranges from about 5 ° C to about 90 ° C and, when the situs comprises a fabric, the water to fabric mass ratio is typically from about 1:1 to about 30:1.
- the present invention provides compositions and methods for the production of a food or animal feed, characterized in that protease according to the invention is mixed with food or animal feed.
- the protease is added as a dry product before processing, while in other embodiments it is added as a liquid before or after processing.
- the enzyme in which a dry powder is used, the enzyme is diluted as a liquid onto a dry carrier such as milled grain.
- the proteases of the present invention find use as components of animal feeds and/or additives such as those described U.S. Pat. No. 5,612,055, U.S. Pat. No. 5,314,692. and U.S. Pat No.
- the enzyme feed additive according to the present invention is suitable for preparation in a number of methods. For example, in some embodiments, it is prepared simply by mixing different enzymes having the appropriate activities to produce an enzyme mix. In some embodiments, this enzyme mix is mixed directly with a feed, while in other embodiments, it is impregnated onto a cereal-based carrier material such as milled wheat, maize or soya flour. The present invention also encompasses these impregnated carriers, as they find use as enzyme feed additives. In some alternative embodiments, a cereal-based carrier (e.g., milled wheat or maize) is impregnated either simultaneously or sequentially with enzymes having the appropriate activities.
- a cereal-based carrier e.g., milled wheat or maize
- a milled wheat carrier is first sprayed with a xylanase, secondly with a protease, and optionally with a ⁇ -glucanase.
- the present invention also encompasses these impregnated carriers, as they find use as enzyme feed additives.
- these impregnated carriers comprise at least one protease of the present invention.
- the feed additive of the present invention is directly mixed with the animal feed, while in alternative embodiments, it is mixed with one or more other feed additives such as a vitamin feed additive, a mineral feed additive, and/or an amino acid feed additive.
- the resulting feed additive including several different types of components is then mixed in an appropriate, amount with the feed.
- the feed additive of the present invention including cereal-based carriers is normally mixed in amounts of 0.01-50 g per kilogram of feed, more preferably 0.1-10 g/kilogram, and most preferably about 1 g/kilogram.
- the enzyme feed additive of the present invention involves construction of recombinant microorganisms that produces the desired enzyme(s) in the desired relative amounts. In some embodiments, this is accomplished by increasing the copy number of the gene encoding at least one protease of the present invention, and/or by using a suitably strong promoter operatively linked to the polynucleotide encoding the protease(s).
- the recombinant microorganism strain has certain enzyme activities deleted (e.g., cellulases, endoglucanases, etc.), as desired.
- the enzyme feed additives provided by the present invention also include other enzymes, including but not limited to at least one xylanase, ⁇ - amylase, glucoamylase, pectinase, mannanase, ⁇ -galactosidase, phytase, and/or lipase.
- the enzymes having the desired activities are mixed with the xylanase and protease either before impregnating these on a cereal-based carrier or alternatively such enzymes are impregnated simultaneously or sequentially on such a cereal-based carrier.
- the carrier is then in turn mixed with a cereal-based feed to prepare the final feed.
- the enzyme feed additive is formulated as a solution of the individual enzyme activities and then mixed with a feed material pre-formed as pellets or as a mash.
- the enzyme feed additive is included in animals' diets by incorporating it into a second (i.e., different) feed or the animals' drinking water.
- the enzyme mix provided by the present invention is not essential that the enzyme mix provided by the present invention be incorporated into the cereal-based feed itself, although such incorporation forms a particularly preferred embodiment of the present invention.
- the ratio of the units of xylanase activity per g of the feed additive to the units of protease activity per g of the feed additive is preferably 1 :0.001-1 ,000, more preferably 1 :0.01-100, and most preferably 1:0.1- 10.
- the enzyme mix provided by the present invention is preferably finds use as a feed additive in the preparation of a cereal-based feed.
- the cereal-based feed comprises at least 25% by weight, or more preferably at least 35% by weight, wheat or maize or a combination of both of these cereals.
- the feed further comprises a protease (i.e., at least one protease of the present invention) in such an amount that the feed includes a protease in such an amount that the feed includes 100-100,000 units of protease activity per kg.
- a protease i.e., at least one protease of the present invention
- Cereal-based feeds provided the present invention according to the present invention find use as feed for a variety of non-human animals, including poultry (e.g., turkeys, geese, ducks, chickens, etc.), livestock (e.g., pigs, sheep, cattle, goats, etc.), and companion animals (e.g., horses, dogs, cats, rabbits, mice, etc.).
- the feeds are particularly suitable for poultry and pigs, and in particular broiler chickens.
- the present invention also provides compositions for the treatment of textiles that include at least one of the proteases of the present invention.
- at least one protease of the present invention is a component of compositions suitable for the treatment of silk or wool (See e.g., U.S. RE Pat. No. 216,034, EP 134,267, U.S. Pat. No. 4,533,359, and EP 344,259).
- the proteases of the present invention find use in a variety of applications where it is desirable to separate phosphorous from phytate. Accordingly, the present invention also provides methods producing wool or animal hair material with improved properties.
- these methods comprise the steps of pretreating wool, wool fibres or animal hair material in a process selected from the group consisting of plasma treatment processes and the Delhey process; and subjecting the pretreated wool or animal hair material to a treatment with a proteolytic enzyme (e.g., at least one protease of the present invention) in an amount effective for improving the properties.
- a proteolytic enzyme e.g., at least one protease of the present invention
- the proteolytic enzyme treatment occurs prior to the plasma treatment, while in other embodiments, it occurs after the plasma treatment.
- it is conducted as a separate step, while in other embodiments, it is conducted in combination with the scouring or the dyeing of the wool or animal hair material.
- At least one surfactant and/or at least one softener is present during the enzyme treatment step, while in other embodiments, the surfactant(s) and/or softener(s) are incorporated in a separate step wherein the wool or animal hair material is subjected to a softening treatment.
- the compositions of the present invention find us in methods for shrink-proofing wool fibers (See e.g., JP 4-327274).
- the compositions are used in methods for shrink-proofing treatment of wool fibers by subjecting the fibers to a low-temperature plasma treatment, followed by treatment with a shrink- proofing resin such as a block-urethane resin, polyamide epochlorohydrin resin, glyoxalic resin, ethylene-urea resin or acrylate resin, and then treatment with a weight reducing proteolytic enzyme for obtaining a softening effect).
- the plasma treatment step is a low-temperature treatment, preferably a corona discharge treatment or a glow discharge treatment.
- the low-temperature plasma treatment is carried out by using a gas, preferably a gas selected from the group consisting of air, oxygen, nitrogen, ammonia, helium, or argon. Conventionally, air is used but it may be advantageous to use any of the other indicated gasses.
- the low-temperature plasma treatment is carried out at a pressure between about 0.1 torr and 5 torr for from about 2 seconds to about 300 seconds, preferably for about 5 seconds to about 100 seconds, more preferably from about 5 seconds to about 30 seconds.
- the present invention finds use in conjunction with methods such as the Delhey process (See e.g., DE-A-43 32 692).
- the wool is treated in an aqueous solution of hydrogen peroxide in the presence of soluble wolframate, optionally followed by treatment in a solution or dispersion of synthetic polymers, for improving the anti-felting properties of the wool.
- the wool is treated in an aqueous solution of hydrogen peroxide (0.1-35% (w/w), preferably 2-10% (w/w)), in the presence of a 2-60% (w/w), preferably 8-20% (w/w) of a catalyst (preferably Na 2 WO 4 ), and in the presence of a nonionic wetting agent.
- the treatment is carried out at pH 8-11 , and room temperature.
- the treatment time depends on the concentrations of hydrogen peroxide and catalyst, but is preferably 2 minutes or less.
- the wool is rinsed with water.
- the wool is further treated in acidic solutions of reducing agents (e.g., sulfites, phosphites etc.).
- the enzyme treatment step carried out for between about 1 minute and about 120 minutes. This step is preferably carried out at a temperature of between about 20°C. and about 60°C, more preferably between about 30°C. and about 50°C.
- the wool is soaked in or padded with an aqueous enzyme solution and then subjected to steaming at a conventional temperature and pressure, typically for about 30 seconds to about 3 minutes.
- the proteolytic enzyme treatment is carried out in an acidic or neutral or alkaline medium which may include a buffer.
- the enzyme treatment step is conducted in the presence of one or more conventional anionic, non-ionic (e.g., Dobanol; Henkel AG) or cationic surfactants.
- a useful nonionic surfactant is Dobanol (from Henkel AG).
- the wool or animal hair material is subjected to an ultrasound treatment, either prior to or simultaneous with the treatment with a proteolytic enzyme.
- the ultrasound treatment is carried out at a temperature of about 50°C for about 5 minutes.
- the amount of proteolytic enzyme used in the enzyme treatment step is between about 0.2 w/w % and about 10 w/w %, based on the weight of the wool or animal hair material.
- the enzyme treatment in order to the number of treatment steps, is carried out during dyeing and/or scouring of the wool or animal hair material, simply by adding the protease to the dyeing, rinsing and/or scouring bath. In some embodiments, enzyme treatment is carried out after the plasma treatment but in other embodiments, the two treatment steps are carried out in the opposite order.
- Softeners conventionally used on wool are usually cationic softeners, either organic cationic softeners or silicone based products, but anionic or non-ionic softeners are also useful.
- useful softeners include, but are not limited to polyethylene softeners and silicone softeners (i.e., dimethyl polysiloxanes (silicone oils)), H-polysiloxanes, silicone elastomers, aminofunctional dimethyl polysiloxanes, aminofunctional silicone elastomers, and epoxyfunctional dimethyl polysiloxanes, and organic cationic softeners (e.g. alkyl quarternary ammonium derivatives).
- the present invention provides compositions for the treatment of an animal hide that includes at least one protease of the present invention.
- the proteases of the present invention find use in compositions for treatment of animal hide, such as those described in WO 03/00865 (Insect Biotech Co., Taejeon-Si, Korea).
- the present invention provides methods for processing hides and/or skins into leather comprising enzymatic treatment of the hide or skin with the protease of the present invention (See e.g., WO 96/11285).
- the present invention provides compositions for the treatment of an animal skin or hide into leather that includes at least one protease of the present invention.
- Hides and skins are usually received in the tanneries in the form of salted or dried raw hides or skins.
- the processing of hides or skins into leather comprises several different process steps including the steps of soaking, unhairing and bating. These steps constitute the wet processing and are performed in the beamhouse.
- Enzymatic treatment utilizing the proteases of the present invention are applicable at any time during the process involved in the processing of leather. However, proteases are usually employed during the wet processing (i.e., during soaking, unhairing and/or bating). Thus, in some preferred embodiments, the enzymatic treatment with at least one of the proteases of the present invention occurs during the wet processing stage.
- the soaking processes of the present invention are performed under conventional soaking conditions (e.g., at a pH in the range pH 6.0 - 11).
- the range is pH 7.0 -10.0.
- the temperature is in the range of 20-30 e C, while in other embodiments it is preferably in the range 24-28 Q C.
- the reaction time is in the range 2-24 hours, while preferred range is 4-16 hours.
- tensides and/or preservatives are provided as desired.
- the second phase of the bating step usually commences with the addition of the bate itself.
- the enzymatic treatment takes place during bating.
- the enzymatic treatment takes place during bating, after the deliming phase.
- the bating process of the presents invention is performed using conventional conditions (e.g., at a pH in the range pH 6.0 -9.0).
- the pH range is 6.0 to 8.5.
- the temperature is in the range of 20-30 s C, while in preferred embodiments, the temperature is in the range of 25-28 s C.
- the reaction time is in the range of 20-90 minutes, while in other embodiments, it is in the range 40-80 minutes.
- the present invention provides bates comprising at least one protease of the present invention.
- a bate is an agent or an enzyme-containing preparation comprising the chemically active ingredients for use in beamhouse processes, in particular in the bating step of a process for the manufacture of leather.
- the present invention provides bates comprising protease and suitable excipients.
- agents including, but not limited to chemicals known and used in the art, e.g. diluents, emulgators, delimers and carriers.
- the bate comprising at least one protease of the present invention is formulated as known in the art (See e.g. , GB-
- the bate of the present invention contains from 0.00005 to
- the bate contains from
- proteases of the present invention find use in numerous applications and settings.
- EXAMPLE 1 Assays In the following Examples, various assays were used, such as protein determinations, application-based tests, and stability-based tests. For ease in reading, the following assays are set forth below and referred to in the respective Examples. Any deviations from the protocols provided below in any of the experiments performed during the development of the present invention are indicated in the Examples. Some of the detergents used in the following Examples had the following compositions. In Compositions I and II, the balance (to 100%) is perfume/dye and/or water. The pH of these compositions was from about 5 to about 7 for Composition I, and about 7.5 to about 8.5 Composition II.
- composition III the balance (to 100%) comprised of water and/or the minors perfume, dye, brightener/SRPI/sodium carboxymethylcellulose/photobleach/MgSo ⁇ PVPVI/suds suppressor/high molecular PEG/clay.
- Composition III C 14 -C ⁇ 5 AS or sodium tallow alkyl 3.0 sulfate LAS 8.0 QAS - Zeolite A 11.0 SKS-6 (dry add) 9.0 MA/AA 2.0 AA - 3Na Citrate 2H 2 O - Citric Acid (Anhydrous) 1.5 DTPA - EDDS 0.5 HEDP 0.2 PB1 - Composition III
- TCA Assay for Protein Content Determination in 96-well Microtiter Plates This assay was started using filtered culture supernatant from microtiter plates grown
- the calculations were performed by subtracting the blank (i.e., no TCA) from the test reading with TCA. If desired, a standard curve can be created by calibrating the TCA readings with AAPF assays of clones with known conversion factors. However, the TCA results are linear with respect to protein concentration from 50 to 500 ppm and can thus be plotted directly against enzyme performance for the purpose of choosing good-performing variants.
- Tris buffer pH 8.6, containing 10 mM CaCI 2 and 0.005% TWEEN®-80 (Tris buffer)
- suc-AAPF-pNA in DMSO suc-AAPF-pNA stock solution
- suc-AAPF-pNA working solution 1 ml AAPF stock was added to 100 ml Tris/Ca buffer and mixed well for at least 10 seconds.
- Reagent A 45.4 g Na 2 B 4 O 7 .10 H2O (Merck 6308) and 15 ml of 4N NaOH are dissolved together to a final volume of 1000 ml (by heating if needed)
- keratin Prior to the incubations, keratin was sieved on a 100 ⁇ m sieve in small portions at a time. Then, 10 g of the ⁇ 100 ⁇ m keratin was stirred in detergent solution for at least 20 minutes at room temperature with regular adjustment of the pH to 8.2. Finally, the suspension was centrifuged for 20 minutes at room temperature (Sorvall, GSA rotor, 13,000 rpm). This procedure was then repeated. Finally, the wet sediment was suspended in detergent to a total volume of 200 ml., and the suspension was kept stirred during pipetting.
- microtiter plates Prior to incubation, microtiter plates (MTPs) were filled with 200 ⁇ l substrate per well with a Biohit multichannel pipette and 1200 ⁇ l tip (6 dispenses of 200 ⁇ l and dispensed as fast as possible to avoid settling of keratin in the tips). Then, 10 ⁇ l of the filtered culture was added to the substrate containing MTPs. The plates were covered with tape, placed in an incubator and incubated at 20 °C for 3 hours at 350 rpm (Innova 4330 [New Brunswick]). Following incubation, the plates were centrifuged for 3 minutes at 3000 rpm (iSigma 6K 15 centrifuge).
- the TNBS reagent was prepared by mixing 1 ml TNBS solution per 50 ml of reagent A. MTPs were filled with 60 ⁇ l TNBS reagent A per well. From the incubated plates, 10 ⁇ l was transferred to the MTPs with TNBS reagent A. The plates were covered with tape and shaken for 20 minutes in a bench shaker (BMG Thermostar) at room temperature and 500 rpm. Finally, 200 ⁇ l of reagent B was added to the wells, mixed for 1 minute on a shaker, and the absorbance at 405 nm was measured with the MTP-reader.
- BMG Thermostar bench shaker
- the PI identifies winners, as well as variants that are less desirable for use under certain circumstances.
- ARIEL® Regular detergent and stir the detergent solution vigorously for at least 30 minutes.
- the detergent was filtered before use in the assay through a 0.22 ⁇ m filter (e.g. Nalgene top bottle filter).
- the detergent was filtered before use in the assay through a 0.22 ⁇ m filter (e.g. Nalgene top bottle filter).
- Microswatches Microswatches of W circular diameter were ordered and delivered by CFT Vlaardingen. The microswatches were pretreated using the fixation method described below. Single microswatches were placed in each well of a 96-well microtiter plate vertically to expose the whole surface area (i.e., not flat on the bottom of the well).
- the swatches were swirled in the solution (using the ladle) for 30 minutes, continuously for the first five minutes and occasionally for the remaining 25 minutes. The solution was discarded and the swatches were rinsed 6 times with approximately 6 liters of distilled water each time. The swatches were placed on top of paper towels to dry. The air- dried swatches were punched using a ! " circular die on an expulsion press. A single microswatch was placed vertically into each well of a 96-well microtiter plate to expose the whole surface area (i.e. not flat on the bottom of the well).
- Enzyme Samples The enzyme samples were tested at appropriate concentrations for the respective geography, and diluted in 10 mM NaCl, 0.005% TWEEN®-80 solution.
- the incubator was set at the desired temperature: 20°C for cold water liquid conditions; 30°C for low-pH liquid conditions; 40°C for European conditions; 20°C for Japanese and North American conditions.
- the pretreated and precut swatches were placed into the wells of a 96-well MTP, as described above.
- the enzyme samples were diluted, if needed, in 10 mM NaCl, 0.005% TWEEN®-80 to 20x the desired concentration.
- the desired detergent solutions were prepared as described above. Then, 190 ⁇ l of detergent solution were added to each well of the MTP. To this mixture, 10 ⁇ l of enzyme solution were added to each well (to provide a total volume to 200 ⁇ l/well).
- the MTP was sealed with a plate sealer and placed in an incubator for 60 minutes, with agitation at 350 rpm. Following incubation under the appropriate conditions, 100 ⁇ l of solution from each well were removed and placed into a fresh MTP. The new MTP containing 100 ⁇ l of solution/well was read at 405 nm in a MTP reader. Blank controls, as well as a control containing a microswatch and detergent but no enzyme were also included.
- the PI identifies winners, as well as variants that are less desirable for use under certain circumstances.
- DMC Dimethylcasein
- PIPES buffer (free acid): Sigma P-1851; 15.1 g is dissolved in about 960 ml water; pH is adjusted : to 7.0 with 4N NaOH, 1 ml 5% TWEEN®- 80 is added and the volume brought up to 1000 ml.
- the final concentration of PIPES and TWEEN®-80 is 50 mM and 0.005% respectively.
- TNBS Picrylsulfonic acid
- Reagent A 45.4 g Na 2 B 4 O 7 .10 H2O (Merck 6308) and 15 ml of 4N NaOH are dissolved together to a final volume of 1000 ml (by heating if needed)
- Reagent B 35.2 g NaH 2 PO 4 .1H 2 O (Merck 6346) and 0.6 g Na 2 SO 3 (Merck 6657) are dissolved together to a final volume of 1000 ml.
- the incubated plates were shaken for a few seconds, after which 10 ⁇ l were transferred to the MTPs with TNBS reagent A.
- the plates were covered with tape and shaken for 20 minutes in a bench shaker (BMG Thermostar) at room temperature and 500 rpm.
- 200 ⁇ l reagent B were added to the wells, mixed for 1 minute on a shaker, and the absorbance at 405 nm was determined using an MTP-reader.
- Thermostability Assay This assay is based on the dimethylcasein hydrolysis, before and after heating of the buffered culture supernatant. The same chemical and reagent solutions were used as described in the dimethylcasein hydrolysis assay.
- the filtered culture supematants were diluted to 20 ppm in PIPES buffer (based on the concentration of the controls in the growth plates). Then, 50 ⁇ l of each diluted supernatant were placed in the empty wells of a MTP. The MTP plate was incubated in an iEMS incubator/shaker HT (Thermo Labsystems) for 90 minutes at 60°C and 400 rpm. The plates were cooled on ice for 5 minutes. Then, 10 ⁇ l of the solution was added to a fresh MTP containing 200 ⁇ l dimethylcasein substrate/well. This MTP was covered with tape, shaken for a few seconds and placed in an oven at 37 °C for 2 hours without agitation. The same detection method as used for the DMC hydrolysis assay was used.
- LAS Stability Assay LAS stability was measured after incubation of the test protease in the presence of 0.06% LAS (dodecylbenzenesulfonate sodium), and the residual activity was determined using the AAPF assay.
- a 10 ⁇ l 0.063% LAS solution was prepared in 52.5 mM Tris buffer pH 8.2.
- the AAPF working solution was prepared by adding 1 ml of 100 mg/ml AAPF stock solution (in DMSO) to 100 ml (100 mM) TRIS buffer, pH 8.6.
- To dilute the supematants flat-bottomed plates were filled with dilution buffer and an aliquot of the supernatant was added and mixed well. The dilution ratio depended on the concentration of the ASP-controls in the growth plates (AAPF activity).
- the desired protein concentration was 80 ppm.
- Ten ⁇ l of the diluted supernatant was added to 190 ⁇ l 0.063% LAS buffer/well.
- the MTP was covered with tape, shaken for a few seconds and placed in an incubator (Innova 4230) at 25°C, for 60 minutes at 200 rpm agitation.
- the AAPF activity was then determined as described above. The calculations were performed as follows: the % Residual Activity was [f-60 valuep 00 / [MO value].
- Test Method First, 50 ⁇ l of scrambled egg substrate were dispensed into each well of a MTP. The plates were allowed to dry at room temperature overnight (about 17 hours), baked in oven at 80°C for 2 hours, then cooled to room temperature. ADW product solution was prepared by dissolving 2.85 g of LH-powder into 1 L water. Only about 15 minutes dissolution time was needed and filtration of the solution was not needed. Then, 1.16 mL artificial hardness solution was added and 2120 mg Na 2 C0 3 was dissolved in the solution.
- Hardness solution was prepared by mixing 188.57g CaCI 2 .2H 2 0 and 86.92g MgCI 2 .6H 2 0 in 1L demi water (equal to 1.28 M Ca + 0.43 M Mg and totally 10000 gpg).
- the above-mentioned amounts of ADW, CaCI 2 and MgCI were already proportionally increased values (200/190x) because of the addition of 10 ⁇ l supernatant to 190 ⁇ l ADW solution.
- ADW solution (190 ⁇ l) was added to each well of the substrate plate.
- the MTPs were processed by addinglO ⁇ l of supernatant to each well and sealing the'plate with tape.
- the plate was placed in a pre-warmed incubator/shaker and secured with a metal cover and clamp. The plate was then washed for 30 minutes at the appropriate temperature (50°C for US) at 700 rpm. The plate was removed from the incubator/shaker. With gentle up and down movements of the liquid, about 125 ⁇ l of the warm supernatant were transferred to an empty flat bottom plate. After cooling, exactly 100 ⁇ l of the dispersion was dispensed into the wells of an empty flat bottom plate. The absorbance at 405 nm was determined using a microtiter plate reader.
- the PI identifies winners, as well as variants that are less desirable for use under certain circumstances.
- EXAMPLE 2 Production of 69B4 protease From the Gram-Positive Alkaliphilic Bacterium 69B4
- This Example provides a description of the Cellulomonas strain 69B4 used to initially isolate the novel protease 69B4 provided by the present invention.
- the alkaliphilic microorganism Cellulomonas strain 69B.4, (DSM 16035) was isolated at 37°C on an alkaline casein medium containing (g L "1 ) (See e.g., Duckworth etal., FEMS Microbiol. Ecol., 19:181- 191 [1996]).
- Solid medium is prepared by the addition of agar (2% w/v).
- MWCO Spectra-Por7 (Spectrum) dialysis tubing.
- the dialysis was performed overnight or until the conductivity of the sample was less than or equal to the conductivity of the MES buffer.
- the dialyzed enzyme sample was purified using a BioCad VISION(Applied Biosystems) with a 10x100mm(7.845 mL) POROS High Density Sulfo-propyl (HS) 20 (20micron) cation-exchange column (PerSeptive Biosystems).
- Protease activity in the fractions was monitored using the pNA assay (sAAPF-pNA assay; DelMar, etal., supra). Protease activity which eluted at 40mM NaCl was concentrated and buffer exchanged(using a 5K MWCO VIVA Science 20mL concentrator) into 20mM MES, pH 5.8, 1mMCaCI2. This material was used for further characterization of the enzyme.
- EXAMPLE 3 PCR Amplification of a Serine Protease Gene Fragment
- PCR amplification of a serine protease gene fragment is described.
- alkaline proteinase (EC 3.4.21.-) from Streptomyces sp. (accession no. PC2053); alkaline serine proteinase I from Streptomyces sp. (accession no. S34672); serine protease from Streptomyces lividans (accession no. CAD4208); putative serine protease from Streptomyces coelicolor A3(2) (accession no. NP_625129); putative serine protease from Streptomyces avermitilis MA-4680 (accession no.
- NP_822175 serine protease from Streptomyces lividans (accession no. CAD42809); putative serine protease precursor from Streptomyces coelicolor A3(2) (accession no. NP_628830). All of these sequences are publicly available from GenBank. These alignments are provided below. In this alignment, two conserved boxes are underlined and shown in bold.
- AAC23545 (1) . —MNHSSR--RTTSLLFTAALAATALVAATTPAS PC2053 (1 ) --MRHTGR-NAIGAAIAASALAFAVPSQAAAN DTLTERAEAAV S34672 (1 ) --MRLKGRTVAIGSALAASA ALSLVPANASSELP SAETAKADALV CAD42808 (1 ) MVGRHAAR-SRRAALTA GALVLTALPSAASAAPPPVPGPRPAVARTPDA
- NP_625129 (1 ) MVGRHAAR-SRRAALTA GALVLTALPSAASAAPPPVPGPRPAVARTPDA
- NP_822175 (1 ) MVHRHVG--AGCAGLSVLATLVLTGLPAAAAIEPP-GPAPAPSAVQPLGA CAD42809 (1 ) MPHRHRHH-RAVGAAVAATAALLVAG SGSASAGTAPAGSAPTAAETLRT
- NP_628830 (1 ) MPHRHRHH-RAVGAAVAATAA VAGLSGSASAGTAPAGSAPTAAETLRT P52320 (1 ) MERTT-LRRRALVAGTATVAVGALALAGLTGVASADPAATAAPPVSA 51 100 AAC23545 (31) AQE ALKRDLG SDAEVAELRAAEAEAVE EEELRDSLGSDFGGV PC2053 (42) ADLPAGVLDAMERDLG SEQEAGLKLVAEHDAALLGET SADLDAFAGSW S3467 (45) EQLPAGMVDAMERDLGVPAAEVGNQLVAEHEAAV EES SEDLSGyAGS CAD42808 (50) ATAPARM SAMERD R APGQAAARPVNEAEAGTRAGMLRNTLGDRFAGA NP_625129 (50) ATAPARMLSAMERDLRLAPGQAAARLVNEAEAGTRAGMLRNTLGDRFAGA
- NP_822175 GNPSTAVLGA QRD HLTDTQAKTR VNEMEAGTRAGRLQNALGKHFAGA CAD42809 (50) DAAPPA LKAMQRDLGIDRRQAERRLVNEAEAGATAGRLRAALGGDFAGA
- NP_628830 50
- DAAPPAL KAMQRDLG DRRQAERRLVNEAEAGATAGRLRAA GGDFAGA P52320 (47) DSLSPGMLAALERDLGLDEDAARSRIANEYRAAAVAAG EKS GARYAGA 101 150 AAC23545 (76) YLDADT-TEITVAVTDPAAVSRVDADDV VDWDFGETALNDFVASLNAI PC2053 (92) LAEGT E WATTSEAEAAEITEAGATAEWDHT AE DSVKDALDTA S34672 (95 IVEGTS—EHWATTDRAEAAEITAAGATATWEHSLAELEAVKDILDEA CAD42808 (100 VSGATSAELTVATTDAADTAAIEAQGAKAAWGRNLAELRAVKEKLDAA
- NP_625129 100 VSGATSAELTVATTDAADTAAIEAQGAKAAWGRNLAE RAVKEKLDAA
- NP_822175 (98 WVHGAASADLTVATTHATDIPAITAGGATAVWKTGLDDLKGAKKKLDSA CAD42809 (100 WVRGAESGTLTVATTDAGDVAAVEARGAEAKVVRHSLADLDAAKARLDTA
- NP_628830 100 WVRGAESGTLTVATTDAGDVAAIEARGAEAKWRHSLADLDAAKARLDTA P52320 (97 RVSGAK-ATLTVATTDASEAARITEAGARAEWGHSLDRFEGVKKSLDKA 151 200 AAC23545 (125 ADT—ADPKVTG YTD ESDAWITT RGGTPAAEELAERAGLDERAVRI PC2053 (139 AES-YDTTDAPVWYVDV TNGW LTSD—VTEAEGFVEAAGVNAAAVDI S34672 (143 ATA-NPEDAAPV YVDV TNEWVLASD— PAAEAFVAASGADASTVRV CAD42808 (150 AVR-TRTRQTPVWYVDV TNRVTVQATG—ASAAAAFVEAAGVPAADVGV
- NP_625129 150 AVR-TRTRQTPVWYVDVKTNRVTVQATG--ASAAAAFVEAAGVPAADVGV
- NP_822175 148 VAHGGTAVNTPVRYVDVRTNRVTLQARS—RAAADALIAAAGVDSGLVDV CAD42809 (150 AAG-LNTADAPVWYVDTRTNTVWEAIR—PAAARSLLTAAGVDGSLAHV
- NP_628830 150 AAG-LNTADAPVWYVDTRTNT WEAIR—PAAARSLLTAAGVDGSLAHV P52 3 20 (146 ALD-KAPKNVPVWYVDVAANRVWNAAS--PAAGQAFLKVAGVDRGLVTV 201 250 AAC2 3 545 (173 VEEDEEPQSLAAIIGGNPYYFGN-YRCSIGFSVRQGSQTGFATAGHCGST PC205 3 (186 QTSDEQPQAFYDLVGGDAYYMGG-GRCSVGFSVTQGSTPGFATAGHCGTV S34672 (190 ERSDESPQPFYDLVGGDAYYIGN-GRCSIGFSVRQGSTPGFVTAGHCGSV CAD42808 (197 RVSPDQPRVLEDLVGGDAYYIDDQARCSIGFSVTKDDQEGFATAGHCGDP
- NP_625129 (197 RVSPDQPRVLEDLVGGDAYYIDDQARCSIGFSVTKDDQEGFATAGHCGDP
- NP_822175 (196 KVSEDRPRALFDIRGGDAYYIDNTARCSVGFSVTKGNQQGFATAGHCGRA CAD42809 (197 KNRTERPRTFYDLRGGEAYYINNSSRCSIGFPITKGTQQGFATAGHCDRA
- NP_628830 (197 KNRTERPRTFYDLRGGEAYYINNSSRCSIGFPITKGTQQGFATAGHCGRA P52 3 20 (193 ARSAEQPRALADIRGGDAYYMNGSGRCSVGFSVTRGTQNGFATAGHCGRV 251 ' 300 AAC23545 (222 GTRVS SPSGTVAGSYFPGRDMG VRITSADTVTPLVNRYNGGTVTV PC205 3 (235 GTSTTGYNQAAQGTFEESSFPGDDMAWVSVNSD NTTPTVNE--GE-VTV S 3 4672 (239 GNATTGFNRVSQGTFRGS FPGRDMA VAVNSNWTPTSLVRNS-GSGVRV CAD42808 (247 GATTTGYNEADQGTFQASTFPGKDMAWVGVNSDWTATPDVKAEGGEKIQL
- NP_625129 (247 GATTTGYNEADQGTFQASTFPGKDMAWVGVNSD TATPDVKAEGGEKIQL
- NP_822175 (246 GAPTAGFNEVAQGTVQASVFPGHDMAWVGVNSD TATPDVAGAAGQNVSI CAD42809 (247 GSSTTGANRVAQGTFQGSIFPGRDMAWVATNSS TATPYVLGAGGQNVQV
- NP_628830 (247 GSSTTGANRVAQGTFQGSIFPGRDMA VATNSS TATPYVLGAGGQNVQV P * 52 3 20 (243 GTTTNGVNQQAQGTFQGSTFPGRDIA VATNANWTPRPLVNGYGRGDVTV 301 350 AAC2 3 545 (268 TGSQEAATGSSVCRSGATTGWRCGTIQSKNQTVRYAEGTVTGLTRTTACA PC2053 (282 SGSTEAAVGASICRSGSTTGWHCGTIQQHNTSVTYPEGTITGVTRTSVCA S34672 (288 TGSTQATVGSSICRSGSTTGWRCGTIQQHNTSVTYPQGTITGVTRTSACA CAD42808 (297 AGSVEALVGASVCRSGSTTGWHCGTIQQHDTSVTYPEGTVDGLTGTTVCA
- NP_625129 (297 AGSVEALVGASVCRSGSTTGWHCGTIQQHDTSVTYPEGTVDGLTETTVCA
- NP_822175 (296 AGSVQAIVGAAICRSGSTTGWHCGTVEEHDTSVTYEEGTVDGLTRTTVCA CAD42809 (297 TGSTASPVGASVCRSGSTTGWHCGTVTQLNTSVTYQEGTISPVTRTTVCA
- NP_6288 3 0 (297 TGSTASPVGASVCRSGSTTGWHCGTVTQLNTSVTYQEGTISPVTRTTVCA P52320 (29 3 AGSTASWGASVCRSGSTTGWHCG IQQLNTSVTYPEGTISGVTRTSVCA 351 400
- AAC23545 (318) EGGDSGGPWLTGSQAQGVTSGGTGDCRSGGITFFQPINPLLSYFGLQLVT PC2053 ( 33 2) EPGDSGGSYISGSQAQGVTSGGSGNCTSGGTTYHQPINPLLSAYGLDLVT S34672 (338) QPGDSGGSFISGTQAQGVTSGGSGNCSIGGTTFHQPVNPILSQYGLTLVR CAD42808 (347) EPGDSGGPFVSGVQAQGTTSGGSGDCTNGGTTFYQPVNPLLSDFGLTLKT
- NP_822175 (346) EPGDSGGSFVSGSQAQGVTSGGSGDCTRGGTTYYQPVNPILSTYGLTLKT CAD42809 (347) EPGDSGGSFISGSQAQGVTSGGSGDCRTGGGTFFQPINALLQNYGLTLKT
- NP_628830 (347) EPGDSGGSFISGSQAQGVTSGGSGDCRTGGETFFQPINALLQNYGLTLKT P52320 (343) EPGDSGGSYISGSQAQGVTSGGSGNCSSGGTTYFQPINPLLQAYGLTLVT 401 450 AAC23545 (368) G PC2053 (382) G S34672 (388) S CAD42808 (397) TSAATQTPAPQDNAAA DA TAGRVYEVGTTVSYDGVRYRCLQSH
- NP_822175 (396) STAPTDTPSDPVDQSG VWAAGRVYEVGAQVTYAGVTYQCLQSH CAD42809 (397) TGGDDGGGDDGG EEPGG-TWAAGTVYQPGDTVTYGGATFRCLQGH
- NP_628830 (397) TGGDDGGGDDGGGDDGGEEPGG-TWAAGTVYQPGDTVTYGGATFRCLQGH P52320 (393 ) SGGGTPTDPPTTPPTDSP GGTWAVGTAYAAGATVTYGGATYRCLQAH 451 468 AAC235 5 (369) (SEQ ID NO:648) PC2053 (383) (SEQ ID NO:649) S34672 ( 389 ) (SEQ ID NO: 650) CAD42808 (441 ) QAQGVGSPASVPALWQRV (SEQ ID NO: 651)
- NP_822175 (439 ) QAQGVWQPAATPALWQRL (SEQ ID NO: 653) CAD42809 ( 441 ) QAYAG EPPNVPALWQRV (SEQ ID NO: 654)
- NP_628830 (446 ) QAYAGWEPPNVPAL QRV (SEQ ID NO: 655) P52320 (440 ) TAQPGWTPADVPAL QRV (SEQ ID NO: 656)
- Two particular regions were chosen to meet the criteria above, and a forward and a reverse primer were designed based on these amino acid regions. The specific amino acid regions used to design the primers are highlighted in black in the sequences shown in the alignments directly above.
- degenerate nucleotide PCR primers were synthesized by MWG-Biotech. The degenerate primer sequences produced were:
- primers TTGWXCGT_FW and GDSGGX_RV successfully amplified a 177 bp region from Cellulomonas sp. isolate 69B4 by PCR, as described below.
- PCR Amplification of a Serine Protease Gene Fragment Cellulomonas sp. isolate 69B4 genomic DNA was used as a template for PCR amplification of putative serine protease gene fragments using the above-described primers.
- PCR was carried out using High Fidelity Platinum Taq polymerase (Catalog number 11304- 102; Invitrogen). Conditions were determined by individual experiments, but typically thirty cycles were run in a thermal cycler (MJ Research). Successful amplification was verified by electrophoresis of the PCR reaction on a 1% agarose TBE gel. A PCR product that was amplified from Cellulomonas sp.
- 69B4 with the primers TTGWXCGT_FW and GDSGGX_RV was purified by gel extraction using the Qiaquick Spin Gel Extraction kit (Catalogue 28704; Qiagen) according to the manufacturer's instructions.
- the purified PCR product was cloned into the commercially available pCR2.1TOPO vector System (Invitrogen) according to the manufacturer's instructions, and transformed into competent E.coli TOP10 cells. Colonies containing recombinant plasmids were visualized using blue/white selection. For rapid screening of recombinant transformants, plasmid DNA was prepared from cultures of putative positive (i.e., white) colonies.
- DNA was isolated using the Qiagen plasmid purification kit, and was sequenced by Baseclear.
- One of the clones contained a DNA insert of 177 bp that showed some homology with several streptogrisin-like protease genes of various Streptomyces species and also with serine protease genes from other bacterial species.
- the DNA and protein coding sequence of this 177 bp fragment is provided in Fig. 13.
- sequences were analyzed by BLAST and other protein translation sequence tools. BLAST comparison at the nucleotide level showed various levels of identity to published serine protease sequences. Initially, nucleotide sequences were submitted to BLAST (Basic BLAST version 2.0). The program chosen was "BlastX", and the database chosen was "nr.” Standard/default parameter values were employed. Sequence data for putative Cellulomonas 69B4 protease gene fragment was entered in FASTA format and the query submitted to BLAST to compare the sequences of the present invention to those already in the database. The results returned for the 177 bp fragment a high number of hits for protease genes from various Streptomyces spp., including S.
- EXAMPLE 4 Isolation of a Polynucleotide Sequence from the Genome of Cellulomonas 69B4 Encoding a Serine Protease by Inverse PCR
- novel DNA primers were designed: 69B4int_RV1 5'-CGGGGTAGGTGACCGAGGAGTTGAGCGCAGTG-3' (SEQ ID NO:14) 69B4int_FW2 5'-GCTCGCCGGCAACCAGGCCCAGGGCGTCACGTC-3' (SEQ ID NO:15) Chromosomal DNA of Cellulomonas sp.
- 69B4 was digested with the restriction enzymes Apa ⁇ , Bam l, BssHW, Kpn ⁇ , Nail, Ncol, Nhel, Pvu ⁇ , Sail or Ssfll, purified using the Qiagen PCR purification kit (Qiagen, Catalogue # 28106) and self-ligated with T4 DNA ligase (Invitrogen) according to the manufacturers' instructions. Ligation mixtures were purified using the Qiagen PCR purification kit, and PCR was performed with primers 69B4int_RV1 and 69B4int_FW2.
- This protease was designated as "69B4 protease," and the gene encoding Cellulomonas 69B4 protease was designated as the "asp gene.”
- the entire sequence of the asp gene was derived by additional inverse PCR reactions with primer 69B40int_FW2 and an another primer: 69B4-for4 (5' AAC GGC GGG TTC ATC ACC GCC GGC CAC TGC GGC C 3' ⁇ SEQ ID NO:16). Inverse PCR with these primers on Ncol, BssHll, Apal and Pvul digested and self-ligated DNA fragments of genomic DNA of Cellulomonas sp. 69B4 resulted in the identification of the entire sequence of the asp gene.
- Nucleotide and Amino Acid Sequences For convenience, various sequences are included below.
- the DNA sequence of the asp gene (SEQ ID NO:1) provided below encodes the signal peptide (SEQ ID NO:9) and the precursor serine protease (SEQ ID NO:7) derived from Cellulomonas strain 69B4 (DSM 16035).
- the initiating polynucleotide encoding the signal peptide of the Cellulomonas strain 69B4 protease is in bold (ATG).
- SEQ ID NO:9 that is operatively linked to the precursor protease (SEQ ID NO:7) derived from Cellulomonas strain 69B4 (DSM 16035).
- the initiating polynucleotide encoding the signal peptide of the Cellulomonas strain 69B4 protease is in bold (ATG).
- the asterisk indicates the termination codon (TGA), beginning with residue 1486.
- Residues 85, 595, and 1162 relate to the initial residues of the N terminal prosequence, mature sequence and Carboxyl terminal prosequence, respectively, are bolded and underlined.
- SEQ ID NO:4 encodes the mature protease derived from Cellulomonas strain 69B4 (DSM 16035).
- the following DNA sequence encodes the signal peptide derived from Cellulomonas strain 69B4 (DSM 16035) 1 ATGACACCAC CACAGTCAC GCGGGCCCTG GCCGTGGCCA CCGCAGCCGC CACACTCCTG TACTGTGGTG CGTGTCAGTG CGCCCGGGAC CGGCACCGGT GGCGTCGGCG GTGTGAGGAC 61 GCAGGCGGCA TGGCCGCCCA GGCC (SEQ ID NO: 5) CGTCCGCCGT ACCGGCGGGT CCGG
- the following sequence is the amino acid sequence (SEQ ID NO:6) of the signal sequence and precursor protease derived from Cellulomonas strain 69B4 (DSM 16035), including the signal sequence [segments 1a-c] (residues 1-28 [-198 to -171]), an N-terminal prosequence [segments 2a-r] (residues 29-198 [-170 to -1]), a mature protease [segments 3a-t] (residues 199-387 [1-189]), and a C-terminal prosequence [segments 4a-l] (residues 388-495 [190-398]) encoded by the DNA sequences set forth in SEQ ID NOS:1 , 2, 3 and 4.
- the N-terminal sequence of the mature protease amino acid sequence is in bold.
- SEQ ID NO:7 is the amino acid sequence of the precursor protease derived from Cellulomonas strain 69B4 (DSM 16035) ( SEQ ID NO:7).
- VNAASGSGAY TMGLTLP SEQ ID NO: 7
- SEQ ID NO:8 The following sequence (SEQ ID NO:8).is the amino acid sequence of the mature protease derived from Cellulomonas strain 69B4 (DSM 16035). The catalytic triad residues H32, D56 and S132 are bolded and underlined.
- SEQ ID NO:9 is the amino acid sequence of the signal peptide of the protease derived from Cellulomonas strain 69B4 (DSM 16035).
- TTGWXCGT_FW 5' ACNACSGGSTGGCRGTGCGGCAC 3' (SEQ ID NO:10)
- SEQ ID NO:11 The following sequence (SEQ ID NO:11) is the reverse primer used to identity a 177 bp fragment of the protease derived from Cellulomonas strain 69B4.
- GDSGGX_RV 5'-ANGNGCCGCCGGAGTCNCC-3' (SEQ ID NO:11)
- protease solution containing 10 - 50 ⁇ g protease was diluted 1 :1 with chilled water in a 1.5 ml microtube.
- 1.0 N HCI was added to a final concentration of 0.1 N HCI, mixed thoroughly and incubated for 10 minutes on ice.
- 50% thchloro-acetic acid (“TCA”) was added to a final concentration of 10% TCA and mixed.
- TCA thchloro-acetic acid
- the sample was incubated for 10 minutes on ice, centrifuged for two minutes and the supernatant discarded. Then, 1 ml of cold 90% acetone was added to resuspend the pellet.
- the resulting sample was then centrifuged for one minute, the supernatant quickly decanted and remaining liquid was removed by vacuum aspiration.
- the dry pellet was dissolved in 12 ⁇ l of 8.0 M urea solution (480 mg urea [Roche, catalog # 1685899]) in 0.65 ml of ammonium bicarbonate solution (final concentration of bicarbonate: 0.5 M) and incubated for 3-5 minutes at 37°C.
- the solution was slowing diluted with 48 ⁇ l of a n-octyl-beta-D-glucopyranoside solution ("o-water”) (200 mg of n-octyl-beta-D-glucopyranoside [C 1 H 28 ⁇ 6 , f.w.
- the elution gradient was formed from 0.1% (v/v) TFA in water and 0.08% (v/v) TFA in acetonitrile at a flow rate of 0.2 ml-min.
- the column compartment was heated to 50°C.
- Peptide elution was monitored at 215 nm and data were collected at 215 nm and 280 nm.
- the samples were then analyzed on a LCQ Advantage mass spectrometer with a Surveyor HPLC (both from Thermo Finnigan).
- the LCQ mass spectrophotometer was run with the following settings: Spray voltage: 4.5kV; Capillary temperature: 225 Q C. Data processing was performed using TurboSEQUEST and Xcalibur (ThermoFinnigan).
- Sequencing of the tryptic digest portions was also performed in part by Argo BioAnalytica. Analysis of the full sequence of the asp gene revealed that it encodes a prosequence protease of 495 amino acids (SEQ ID NO:6). The first 28 amino acids were predicted to form a signal peptide.
- the mass of the mature chain of 69B4 protease as produced by Cellulomonas strain 69B4 has a molecular weight of 18764 (determined by MALDI-TOF).
- the sequence of the N-terminus of the mature chain was also determined by MALDI-TOF analysis and starts with the sequence FDVIGGNAYTIGGR (SEQ ID NO:17).
- the 69B4 protease has a unique precursor structure with NH 2 - and COOH terminal pro-sequences, as is known to occur with some other enzymes (e.g., T. aquaticus aqualysin I; See e.g., Lee etal., FEMS Microbiol. Lett., 1 :69-74 [1994]; Sakamoto etal., Biosci. Biotechnol. Biochem., 59:1438-1443 [1995]; Sakamoto etal., Appl. Microbiol. Biotechnol., 45:94-101 [1996]; Kim etal., Biochem. Biophys. Res.
- the amino acid sequence of the Cellulomonas 69B4 signal sequence and precursor protease are aligned with the signal sequence and precursor protease Aqualysin I of Thermus aquaticus (COOH- terminal pro-sequence of Aqualysin I is underlined and in bold).
- Aqualysin I (493) YLWRIYAYSGSGMYEFWI.QRP ( SEQ ID NO : 644 ) 69B4 (475) YRYWNAASGSGAYTMGLTLP ( SEQ ID NO : 645 ) Consensus (501) Y W I A SGSG Y L P ( SEQ ID NO : 646 )
- sequences of three internal peptides of the purified enzyme from Cellulomonas sp. 69B4 having proteolytic activity were determined by MALDI-TOF analysis. All three peptides were also identified in the translation product of the isolated asp gene, confirming the identification of the correct protease gene (See, SEQ ID NO:1, above).
- Sg-StreptogrisinC mature (1) ADIRGGDAYYMNGSGRCSVGFSVTRGTQNGFATAGHCGRVGTTTNG— N Sg-StreptogrisinBmature (1) —ISGGDAIYSST-GRCSLGFNVRSGSTYYFLTAGHCTDGATTW ANSAR Sg-StreptogrisinAmature (1) --IAGGEAITTGG-SRCSLGFNVSVNGVAHALTAGHCTNISAS S Sg-StreptogrisinDmature (1) --IAGGDAIWGSG-SRCSLGFNWKGGEPYFLTAGHCTESVTSWSD-TQG Consensus (1) IAGGDAIY G SRCSLGFNV G YFLTAGHCT GTTW 51 100 Asp mature (41) ANPTGTFAGSSFPGNDYAFVRTGAGVNLLAQVNNYSGGRVQVAGHTAAPV
- Sg-StreptogrisinC mature SYISGSQAQGVTSGGSGNCSSGGTTYFQPINPLLQAYGLTLVTSGGGTPT Sg-StreptogrisinBmature (144) PLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY Sg-StreptogrisinAmature (140) SLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL Sg-StreptogrisinDmature (147) ALFAGDTALGLTSGGSGDCSSGGTTFFQPVPEALAAYGAEIG Consensus (151) SLFAGS ALGLTSGGSGNCSSGGTTFFQPV EALSAYGLTVI 201 250 Asp mature (190)
- Sg-StreptogrisinC mature (198) DPPTTPPTDSPGGTWAVGTAYAAGATVTYGGATYRCLQAHTAQPGWTPAD Sg-StreptogrisinBmature (186) Sg-StreptogrisinAmature (182) Sg-StreptogrisinDmature (189) Consensus (201) 251 Asp mature (190) (SEQ ID NO: 8) Sg-StreptogrisinC mature (248) VPALWQRV (SEQ ID NO: 639) Sg-StreptogrisinBmature (186) (SEQ ID NO: 640) Sg-StreptogrisinAmature (182) (SEQ ID NO: 641) Sg-Stre togrisinDmature (189) (SEQ ID NO: 642) Consensus (251) (SEQ ID NO: 643)
- proteases homologous in protein sequence to the mature domain of ASP were searched for using BLAST. Those identified were then aligned using the multiple sequence alignment program clustalW.
- the numbers on the top of the alignment below refer to the amino-acid sequence of the mature ASP protease.
- the numbers at the side of the alignment are sequence identifiers, as described at the bottom of the alignment.
- SAM-P20 (Streptomyces coelicolor) 6 SAM-P20 (Streptomyces albogriseolus) 7 Streptogrisin B (Streptomyces griseus)0 8 Glutamyl endopeptidase II (Streptomyces griseus) 9 Glutamyl endopeptidase II (Streptomyces fradiae) 10 Streptogrisin D (Streptomyces albogriseolus) 11 Streptogrisin D (Streptomyces coelicolor) 12 Streptogrisin D (Streptomyces griseus)5 13 Subfamily S1 E unassigned peptidase (SalO protein) (Streptomyces lividans) 14 Subfamily S1 E unassigned peptidase (SALO protein) (Streptomyces coelicolor) 15 Streptogrisin D (Streptomyces platensis) 16 Subfamily S1 E unassigned peptida
- Subfamily S1 E unassigned peptidase (SC10G8.13C protein) (Streptomyces coelicolor)
- Subfamily S1 E unassigned peptidase (SC10A5.18 protein) (Streptomyces coelicolor)
- EXAMPLE 5 Screening for Novel Homologues of 69B4 Protease by PCR
- Bacterial strains of the suborder Micrococcineae, and in particular from the family Cellulomonadaceae and Promicromonosporaceae were ordered from the German culture collection, DSMZ (Braunschweig) and received as freeze dried cultures. Additional strains were received from the Belgian Coordinated Collections of Microorganisms, BCCMTM/LMG (University of Ghent).
- the freeze-dried ampoules were opened according to DSMZ instructions and the material rehydrated with sterile physiological saline (1.5 ml) for 1 h.
- Well-mixed, rehydrated cell suspensions 300 ⁇ L were transferred to sterile Eppendorf tubes for subsequent PCR.
- PCR Methods i) Pretreatment of the Samples The rehydrated microbial cell suspensions were placed in boiling water bath for 10 min. The suspensions were then centrifuged at 16000 rpm for 5 min. (Sigma 1-15 centrifuge) to remove cell debris and remaining cells, the clear supernatant fraction serving as template for the PCR reaction.
- FIG. 1 provides a phylogeny tree of ASP protease. The phylogeny of this protease was examined by a variety of approaches from mature sequences of similar members of the chymotrypsin superfamily of proteins and ASP homologues for which significant mature sequence has been deduced.
- the phylogenetic tree of Figure 2 was constructed from aligned sequences (positions 16 -181 of SEQ ID NO:8) using TREECONW v.1.3b (Van de Peer and De Wachter, Comput. Appl. Biosci., 10:569 - 570 [1994]) and with tree topology inferred by the Neighbor-Joining algorithm (Saitou and Nei, Mol. Biol. Evol., 4:406 - 425 [1987]).
- Cellulomonas flavigena (!) Cellulomonas biazotea (1) Cellulomonas find (1)
- Cellulomonas iranensis Cellulomonas cellasea (1) v C. xylanilytica (1) Oerskovia turbata (51) VLRALQRDLGLSAKDATKR AFQSDAASTEDA ADS DAYAGAWVDPARN Oerskoviatician] Cm. cellulans (1) PRAAGRAARSSGSRASAS Pm. citrea (1) . Pm. sukumoe (1) 69B4 (ASP) mature (1) Consensus (51) 101 150 69B4 (ASP) complete (100) VLYVATTDEDAVEEVEGEGATAV VEHSLADLEA KTVLDAALEGHDDVP Cellulomonas gelida (1)
- Cellulomonas flavigena (1) Cellulomonas biazotea (1) KQTASEFVIRLTIGELNLAAA SPLPIGHA STA Cellulomonas fimi (1) Cellulomonas iranensis (! Cellulomonas cellasea ( 2 ) GRVRQ PLRGHDV PARERDPAGLRSASRPGLTRSRRAR DAAGPSARVA C. xylanilytica (1) Oerskovia turbata (101) TLYVGVADRAEAKEVRSAGATPVWDHTLAELDTWKAALDGELNDPAGVP Oerskovia servingnsis (! Cm.
- Cellulomonas iranensis (1) Cellulomonas cellasea ( 52 ) AWYVDVPTNK WESVG- -DTAAAADAVAAAG PADAVT ATTEAPRTFV C. xylanilytica (1) Oerskovia turbata (151) S FVDVTTNQVWNVHDGGRALAE AAASAGVPADAITYVTTTEAPRPLV O.jenenensis revi (!) Cm. cellulans ( 69 ) RRSSSRTARQRGPEVRAQRRGRPRVGAGEQSASTPPGAHRGTRGAVRAHG Pm. citrea (1) Pm.
- Cellulomonas iranensis (1 FPGNDYAWVQVGSGDTPRGLVN YAGGTVRVTGSQQAAVG Cellulomonas cellasea (140 SPSGTFRGSSFPGNDYA VQVASGNTPRGLVNNHSGGTVRVTGSQQAAVG C.
- Cellulomonas iranensis 86 Cellulomonas cellasea (240 VAGTQAQGVTSGGSGNCRYGGTTYFQPVNEILQAYGLR VLG-HARGGPS C.
- xylanilytica 127 IAGTQARGVTSGGSGNC Oerskovia turbata (341 LAGNQAQGVTSGGSGNCSSGGTTYFQPVNEALGGYGLTLVTSDGGGPSRR Oerskovia enensis (127 LAGNQAQGLTSGGSGNCSSGGTTYFQPVNEALSAYGLTLVTSGGRGNC— Cm.
- Cellulomonas flavigena (186) Cellulomonas biazotea ( 276 ) TTCTGYARTYTGSLASRQSAVQPSGSYVTVGSSGTIRVCLDGPSGT Cellulomonas fimi (145)
- Cellulomonas iranensis (86 ) Cellulomonas cellasea (289) -PARRAPAPPARA C. xylanilytica (144) Oerskovia turbata 391) RPGARAMRGPTRAASRPGRRSRSERFVRHDRGRATGCA- Oerskovia réellensis 175) Cm. cellulans 319) VHRRPRVRLQ Pm. citrea (86) Pm.
- Cellulomonas iranensis (86) Cellulomonas cellasea 301) C. xylanilytica 144) Oerskovia turbata 429) Oerskovia réellensis 175) Cm. cellulans 329) Pm. citrea (86) Pm. sukumoe (86) 69B4 (ASP) mature 190) Consensus 451) 501 69B4 (ASP) complete 488) YTMGLTLP (SEQ ID NO: :6) Cellulomonas gelida 147) YTLGATTP (SEQ ID NO: :60)
- Cellulomonas flavigena 186) (SEQ ID NO: :54) Cellulomonas biazotea 336) (SEQ ID NO: :56) Cellulomonas fimi 145) (SEQ ID NO: :58)
- Cellulomonas iranensis (86) (SEQ ID NO: :62) Cellulomonas cellasea 301) (SEQ ID NO: :64) C. xylanilytica 144) (SEQ ID NO: :66) Oerskovia turbata 429) (SEQ ID NO: :68) Oerskovia réellensis 175) (SEQ ID NO: :70) Cm. cellulans 329) (SEQ ID NO:72) Pm. citrea (86) (SEQ ID NO: :74) Pm. sukumoe (86) (SEQ ID NO: :76) 69B4 (ASP) mature 190) (SEQ ID NO: :8) Consensus 501) (SEQ ID NO: :647)
- Oerskovia servingnsis DSM 46000 10. Oerskovia turbata DSM 20577 11. Cellulosimicrobium cellulans DSM 20424 12. Xylanibacterium ulmi LMG21721 13. Isoptericola variabilis DSM 10177 14. Xylanimicrobium pachnodae DSM 12657 15. Promicromonospora citrea DSM 43110 16. Promicromonospora sukumoe DSM 44121 17.
- Agromyces ramosus DSM 43045 The strains were first grown on Heart Infusion/skim milk agar plates (72 h, 30°C) to confirm strain purity, protease reaction by clearing of the skim milk and to serve as inoculum. Bacterial strains were cultivated on Brain Heart Infusion broth supplemented with casein (0.8% w/v) in 100/500 Erlenmeyer flasks with baffles at 230 rpm, 30°C for 5 days. Microbial growth was checked by microscopy. Supematants were separated from cells by centrifugation for 30 min at 4766 x g. Further solids were removed by centrifugation at 9500 rpm. Supematants were concentrated using Vivaspin 20 ml concentrator (Vivascience), cutoff 10 kDa, by centrifugation at 4000 x g. Concentrates were stored in aliquots of 0.5 mL at -20°C.
- the primary antibody (EP034323) for the immunoblotting reaction prepared by Eurogentec (Liege Science Park, Seraing, Belgium) was raised against 2 peptides consisting of amino acids 151-164 and 178-189 in the 69B4 mature protease (SEQ ID NO:8), namely: TSGGSGNCRTGGTT (epitope 1 ; SEQ ID NO:51) and LRMITTDSGSSP (epitope 2;
- Electrophoresis SDS-PAGE was performed in duplicate using NuPAGE 10% Bis-Tris gels (Invitrogen) with MES-SDS running buffer at 100 v for 5 min. and 200 v constant. Where possible,25 ⁇ L sample were loaded in each slot. One gel of each pair was stained with Coomassie Blue and the other gel was used for immunoblotting using the Boehringer Mannheim chromogenic Western blotting protocol (Roche).
- Transfer buffer Tris (0.25M) - glycine (1.92M) - methanol (20% v/v).
- the PVDF membrane was pre-wetted by successive moistening in methanol, deionized water, and finally transfer buffer.
- the PAGE gel was briefly washed in deionized water and transferred to blotting pads soaked in transfer buffer, covered with pre-wetted PVDF membrane and pre-soaked blotting pads. Blotting was performed in transfer buffer at 400 mA constant for 2.5-3 h.
- the membrane was briefly washed (2x) in Tris buffered saline (TBS) (0.5M Tris, 0.15M NaCl, pH7.5).
- TBS Tris buffered saline
- Non-specific antibody binding was prevented by incubating the membrane in 1% v/v mouse/rabbit Blocking Reagent (Roche) in maleic acid solution (100 mM maleic acid, 150 mM NaCl, pH7.5) overnight at 4°C.
- the primary antibody used in these reactions was EP034323 diluted 1:1000.
- the reaction was performed with the Ab diluted in 1% Blocking Solution with a 30 min. action time.
- the membrane was washed 4x 10 min. in TBST (TSB + 0.1% v/v Tween 20).
- the secondary antibody consisted of anti-mouse/anti-rabbit IgG (Roche) 73 ⁇ L in 20 ml in 1% Blocking Solution with a reaction time of 30 min.
- the membrane was washed 4x 15 min. in TBST and the substrate reaction (alkaline phosphatase) performed with BM Chromogenic Western Blotting Reagent (Roche) until staining occurred.
- the results of the cross-reactivity with primary polyclonal antibody are shown in Table 6-1.
- Cellulomonas biazotea DSM 20112 2. Cellulomonas flavigena DSM 20109 3. Cellulomonas fimi DSM 20113 4. Cellulomonas cellasea DSM 20118 5. Cellulomonas gelida DSM 20111 6. Cellulomonas iranensis (DSM 14785) 7. Oerskovia servingnsis DSM 46000 8. Oerskovia turbata DSM 20577 9. Cellulosimicrobium cellulans DSM 20424 10. Promicromonospora citrea DSM 43110 11.
- Promicromonospora sukumoe DSM 44121 These bacterial strains were cultivated on Brain Heart Infusion broth or Tryptone Soya broth in 100/500 Erlenmeyer flasks with baffles at 230 rpm, 30°C for 2 days. Cells were separated from the culture broth by centrifugation for 30 min at 4766 x g. Chromosomal DNA was obtained by standard phenol/chloroform extraction method known in the art from cells digested by lysozyme/EDTA (See e.g., Sambrook etal., supra). Chromosomal DNA was digested with the restriction enzymes selected from the following list: Apal, BamYM, Bss ll, Kpnl, Na ⁇ , Ncol, Nhel, Pvul, Sail or Sstil.
- nucleotide and amino acid sequences of these organisms are provided below. In these listings, the mature protease is indicated in bold and the signal sequence is underlined.
- C. flavigena (DSM 20109) 1 6TCGACGTCA TCGGGGGCAA CGCGTACTAC ATCGGGTCGC GCTCGCGGTG CAGCTGCAGT AGCCCCCGTT GCGCATGATG TAGCCCAGCG CGAGCGCCAC 51 CTCGATCGGG TTCGCGGTCG AGGGCGGGTT CGTCACCGCG GGGCACTGCG GAGCTAGCCC AAGCGCCAGC TCCCGCCCAA GCAGTGGCGC CCCGTGACGC 101 GGCGCGCGGG CGCGCGAGCACG TCGTCACCGT CGGGGACCTT CCGCGGCTCG CCGCGCCC GCGCTCGTGC AGCAGTGGCA GCCCCTGGAA GGCGCCGAGC 151 TCGTTCCCCG GCAACGACTA CGCGTGGGTC CAGGTCGCCT CGGGCAACAC AGCAAGGGGC CGTTGCTGAT GCGCACCCAG GTCCAGCGGA GCCCGTTGTG 201 GCCGCGCGGG CTGGTGA
- DSM 20109 Cellulomonas flavigena (DSM 20109) 1 VDVIGGNAYY IGSRSRCSIG FAVEGGFVTA GHCGRAGAST SSPSGTFRGS 51 SFPGNDYAWV QVASGNTPRG LVNNHSGGTV RVTGSQQAAV GSYVCRSGST 101 TGWRCGYVRA YNTTVRYAEG SVSGLIRTSV CAEPGDSGGS LVAGTQAQGV 151 TSGGSGNCRY GGTTYFQPVN EILQDQPGPS TTRAL (SEQ ID NO: 54)
- Oerskovia turbata (DSM 20577) 1 ATGGCACGAT CATTCTGGAG GACGCTCGCC ACGGCGTGCG CCGCGACGGC TACCGTGCTA GTAAGACCTC CTGCGAGCGG TGCCGCACGC GGCGCTGCCG 51 ACTGGTTGCC GGCCCCGCAG CGCTCACCGC GAACGCCGCG ACGCCCACCC TGACCAACGG CCGGGGCGTC GCGAGTGGCG CTTGCGGCGC TGCGGGTGGG 101 CCGACACCCC GACCGTTTCA CCCCAGACCT CCTCGAAGGT CTCGCCCGAG GGCTGTGGGG CTGGCAAAGT GGGGTCTGGA GGAGCTTCCA GAGCGGGCTC 151 GTGCTCCGCGCG CCCTCCAGCG GGACCTGGGG CTGAGCGCCA AGGACGCGAC CACGAGGCGC GGGAGGTCGC CCTGGACCCC GACTCGCGGT TCCTGCGCTG 201 GAAGCGTCTG GCGTTCCAGT CC
- Oerskovia turbata (DSM 20577) 1 MARSFWRTLA TACAATALVA GPAALTANAA TPTPDTPTVS PQTSSKVSPE 51 VLRALQRDLG LSAKDATKRL AFQSDAASTE DALADSLDAY AGAWVDPARN 101 TLYVGVADRA EAKEVRSAGA TPVWDHTLA ELDTWKAALD GELNDPAGVP 151 SWFVDVTTNQ VWNVHDGGR ALAELAAASA GVPADAITYV TTTEAPRPLV 201 DWGGNAYTM GSGGRCSVGF AVNGGFITAG HCGSVGTRTS GPGGTFRGSN 251 FPGNDYAWVQ VDAGNTPVGA VNNYSGGRVA VAGSTAAPVG ASVCRSGSTT 301 GWHCGTIGAY NTSVTYPQGT VSGLIRTNVC AEPGDSGGSL LAGNQAQGVT 351 SGGSGNCSSG GTTYFQPVNE ALGGYGLTLV TSDGGGPS
- DSM 20424 Cellulosimicrobium cellulans (DSM 20424) 1 PRAAGRAARS SGSRASASTS PGPTSVTASA SSCGRATGRR QRWTFEADGT 51 VRAGGKCMDV AWAPRPTARR SSSRTARQRG PEVRAQRRGR PRVGAGEQSA 101 STPPGAHRGT RGAVRAHGDV RGGDRYITRD PGASSGSACS IGYAVQGGFV 151 TAGHCGRGGT RRVLTASWAR MGTVQAASFP GHDYAWVRVD AGFSPVPRVN 201 NYAGGTVDVA GSAEAPVGAS VCRSGATTGW RCGVIEQKNI TVNYGNGDVP 251 GLVRGSACAE GGDSGGSVIS GNQAQGVTSG RINDCSNGGK FLYQPDRRPV 301 ARDHGRRVGQ RARRARGQVH RRPRVRLQ (SEQ ID NO: 72)
- Promicromonospora citrea (DSM 43110) 1 TTCCCCGGCA ACGACTACGC GTGGGTGAAC ACGGGCACGG ACGACACCCT AAGGGGCCGT TGCTGATGCG CACCCACTTG TGCCCGTGCC TGCTGTGGGA 51 CGTCGGCGCC GTGAACAACT ACAGCGGCGG CACGGTCAAC GTCGCGGGCT GCAGCCGCGG CACTTGTTGA TGTCGCCGCC GTGCCAGTTG CAGCCCGA 101 CGACCCGTGC CGCCGTCGGC GCGACGGTCT GCCGCTCGGG CTCCACGACC GCTGGGCACG GCGGCAGCCG CGCTGCCAGA CGGCGAGCCC GAGGTGCTGG 151 GGCTGGCACT GCGGCACCAT CCAGGCGCTG AACGTCGG TCACCTACGC CCGACCGTGA CGCCGTGGTA GGTCCGCGAC TTGCGCAGCC AGTGGATGCG 201 CGAGGGCACC GTGAGCGGCC TCATCC
- Promicromonospora citrea (DSM 43110) 1 FPGNDYAWVN TGTDDTLVGA VNNYSGGTVN VAGSTRAAVG ATVCRSGSTT 51 GWHCGTIQAL NASVTYAEGT VSGLIRTNVC AEPGD (SEQ ID NO: 74)
- Promicromonospora sukumoe (DSM 44121) 1 TTCCCCGGCA ACGACTACGC GTGGGTGAAC GTCGGCTCCG ACGACACCCC AAGGGGCCGT TGCTGATGCG CACCCACTTG CAGCCGAGGC TGCTGTGGGG 51 GATCGGTGCG GTCAACAACT ACAGCGGCGG CACCGTGAAC GTCGCGGGCT CTAGCCACGC CAGTTGTTGA TGTCGCCGCC GTGGCACTTG CAGCGCCCGA 101 CGACCCAGGC CGCCGTCGGC TCCACCGTCT GCCGCTCCGG TTCCACGACC GCTGGGTCCG GCGGCAGCCG AGGTGGCAGA CGGCGAGGCC AAGGTGCTGG 151 GGCTGGCACT GCGGCACCAT CCAGGCCTTC AACGCGTCGG TCACCTACGC CCGACCGTGA CGCCGTGGTA GGTCCGGAAG TTGCGCAGCC AGTGGATGCG 201 CGAGGGCACC GTGTCCGGCC TG
- Promicromonospora sukumoe (DSM 44121) 1 FPGNDYAWVN VGSDDTPIGA VNNYSGGTVN VAGSTQAAVG STVCRSGSTT 51 GWHCGTIQAF NASVTYAEGT VSGLIRTNVC AEPGD (SEQ ID NO: 76)
- Xylanibacterium ulmi (LMG 21721) 1 GCCGCTGCTC GATCGGGTTC GCCGTGACGG GCGGCTTCGT GACCGCCGGC CGGCGACGAG CTAGCCCAAG CGGCACTGCC CGCCGAAGCA CTGGCGGCCG 51 CACTGCGGAC GGTCCGGCGC GACGACGACG TCCGCGAGCG GCACGTTCGC GTGACGCCTG CCAGGCCGCG CTGCTGCTGC AGGCGCTCGC CGTGCAAGCG 101 CGGGTCCAGC TTTCCCGGCA ACGACTACGC CTGGGTCCGC GCGGCCTCGG GCCCAGGTCG AAAGGGCCGT TGCTGATGCG GACCCAGGCG CGCCGGAGCC 151 GAACACGCCG GTCGGTGCGG TGAACCGCTA CGACGGCAGC CGGGTGACCG CTTGTGCGGC CAGCCACGCC ACTTGGCGAT GCTGCCGTCG GCCCACTGGC 201 TGGCCGGGTC CACC
- Inverse PCR was used to determine the full-length serine protease genes from chromosomal DNA of bacterial strains of the suborder Micrococcineae shown by PCR or immunoblotting to be novel homologues of the new Cellulomonas sp. 69B4 protease described herein.
- Digested DNA was purified using the PCR purification kit (Qiagen, Catalogue # 28106), and self-ligated with T4 DNA ligase (Invitrogen) according to the manufacturers' instructions.
- Ligation mixtures were purified with the PCR purification kit (Qiagen) and a PCR was performed with primers selected from the following list;
- RV-2 turb 5' - CGGCCCCGAGGTGCGGGTGCCG - 3' (SEQ ID NO:84)
- RAGE Genome Walking Using Rapid Amplification of Genomic Ends
- RAGE A genome walking methodology (RAGE) known in the art was used to determine the full-length serine protease genes from chromosomal DNA of bacterial strains of the suborder Micrococcineae shown by PCR or immunoblotting to be novel homologues of the new Cellulomonas sp. 69B4 protease.
- RAGE was performed using the Universal GenomeWalkerTM Kit (BD Biosciences Clontech), some with modifications to the manufacturer's protocol (BD Biosciences user manual PT3042-1 , Version # PR03300).
- PCR was performed with primers (Invitrogen, Paisley, UK) selected from the following list (listed in 5' to 3' orientation); RV-1 Rest ACCCACGCGTAGTCGTTGCC (SEQ ID NO:79)
- RV-1 Cellul ACCCACGCGTAGTCGTKGCCGGGG (SEQ ID NO:80) RV-2 biaz-fimi TCGTCGTGGTCGCGCCGG (SEQ ID NO:81) RV-2 cella-flavi CGACGTGCTCGCGCCCG (SEQ ID NO:82) RV-2 cellul CGCGCCCAGCTCGCGGTG (SEQ ID NO:83) RV-2 turb CGGCCCCGAGGTGCGGGTGCCG (SEQ ID NO:84)
- Fw-1 biaz-fimi CAGCGTCTCCGGCCTCATCCGC (SEQ ID NO:85) Fw-1 cella-flavi CTCGGTCTCGGGCCTCATCCGC (SEQ ID NO:86) Fw-1 cellul CGACGTTCCCGGCCTCGTGCGC (SEQ ID NO:87) Fw-1 turb CACCGTCTCGGGGCTCATCCGC (SEQ ID NO:88) Fw-2 rest AGCARCGTGTGCGCCGAGCC (SEQ ID NO:89) Fw-2 cellul GGCAGCGCGTGCGCGGAGGG (SEQ ID NO:90) Fw-1 gelida GCCGCTGCTCGATCGGGTTC (SEQ ID NO:91) Rv-1 gelida GCAGTTGCCGGAGCCGCCGGACGT (SEQ ID NO:92) Flavi FW1 TGCGCCGAGCCCGGCGACTCCGGC (SEQ ID NO:93) Flavi FW2 GGCACGACGTACTTCCAGCCCGTGAAC (SEQ ID NO
- Turb FW signal ATGGCACGATCATTCTGGAGGACGCTCGCCACGGCG (SEQ ID NO:116)
- the transformants were incubated (37°C, 260 rpm, 16 hours) in 2xTY medium with 100 ⁇ g/ml ampicillin.
- the isolated plasmid DNA (isolated using the Qiagen Qiaprep pDNA isolation kit) was sequenced by BaseClear.
- Amino acid sequence information for Asp- matu re-protease homologues is available from 13 species: 1. Cellulomonas biazotea DSM 20112 2. Cellulomonas flavigena DSM 20109 3. Cellulomonas fimi DSM 20113 4. Cellulomonas cellasea DSM 20118 5. Cellulomonas gelida DSM 20111 6. Cellulomonas iranensis DSM 14784 7. Cellulomonas xylanilytica LMG 21723 8. Oerskovia servingnsis DSM 46000 9. Oerskovia turbata DSM 20577 9. Oerskovia turbata DSM 20577 10.
- Cellulosimicrobium cellulans DSM 20424 11. Promicromonospora citrea DSM 43110 12. Promicromonospora sukumoe DSM 44121 13. Xylanibacterium ulmi LMG 21721 Notably, the sequence from Cellulomonas gelida at 48 amino acids is too short for useful consensus alignment. Sequence alignment against Asp-mature for the remaining 12 species are provided herein. To date, complete mature sequence has been determined for Oerskovia turbata, Cellulomonas cellasea, Cellulomonas biazotea and Cellulosimicrobium cellulans.
- the present invention encompass the ASP protease isolated from Cellulomonas strain 69B4, as well as other homologous proteases.
- the nucleotide numbering is based on full-length gene of 69B4 protease (SEQ ID NO:2), where nt 1 - 84 encode the signal peptide, nt 85 - 594 encode the N-terminal prosequence, nt 595 - 1161 encode the mature 69B4 protease, and nt 1162 - 1485 encode the C-terminal prosequence.
- Table 7-2 provides information regarding the translated amino acid sequence data in natural isolate strains compared with full-length ASP.
- micropuhfied ASP homologues were subjected to mass spectrometry-based protein sequencing procedures which consisted of these major steps: micropurification, gel electrophoresis, in-gel proteolytic digestion, capillary liquid chromatography electrospray tandem mass spectrometry (nanoLC-ESI-MS/MS), database searching of the mass spectrometric data, and de novo sequencing. Details of these steps are described what follows. As described previously in Example 6, concentrated culture sample (about 200 ml) was added to 500ml 1M CaCI2 and centrifuged at 14,000 rpm (model 5415C Eppendorf) for 5 min. The supernatant was cooled on ice and acidified with 200 ml 1 N HCI.
- Peptides were loaded on a pre-column (PepMap100 C18, 5um, 100A, 300um ID x 1mm; Dionex) and chromatographed on capillary columns (Biobasic C18 75um x 10cm; New Objectives) using a gradient from 0 to 100% solvent B in 45min at a flow rate of 200nl_/min (generated using a static split from a pump flow rate of 5ul_/min).
- Solvent A consisted of 0.1% formic acid in water; and solvent B was 0.1% formic acid in acetonitrile.
- the mass spectrometer was operated with the following parameters: spray voltage of 3.1 kV, desolavation zone at 150C, mass spectra acquired from 400 to 1900 m/z, resolution of 6000 in v-mode. Tandem MS spectra were acquired in data dependent mode with two most intense peaks selected and fragmented with mass dependent collision energy (as specified by vendor) and collision gas (argon) at 2.5x10-5 torr. The identities of the peptides were determined using a database search program (Mascot, Matrix Science) using a database containing ASP homologue DNA-obtained sequences.
- EXAMPLE 9 Protease Production in Streptomyces lividans This Example describes experiments conducted to develop methods for production of protease by S. lividans.
- a plasmid comprising a polypeptide encoding a polypeptide having proteolytic activity was constructed and used such vector to transform Streptomyces lividans host cells The methods used for this transformation are more fully described in US Patent No. 6,287,839 and WO 02/50245, both of which are herein expressly incorporated by reference.
- One plasmid developed during these experiments was designated as "pSEG69B4T.” The construction of this plasmid made use of one pSEGCT plasmid vector (See, WO 02/50245).
- a glucose isomerase (“Gl”) promoter operably linked to the structural gene encoding the 69B4 protease was used to drive the expression of the protease.
- a fusion between the Gl-promoter and the 69B4 signal-sequence, N-terminal prosequence and mature sequence was constructed by fusion-PCR techniques as a Xbal-Bam l fragment. The fragment was ligated into plasmid pSEGCT digested with Xbal and Bam l, resulting in plasmid pSEG69B4T (See, Figure 6).
- pSEA469B4CT An additional plasmid developed during the experiments was designated as "pSEA469B4CT" (See, Figure 7). As with the pSEG69B4T plasmid, one pSEGCT plasmid vector was used to construct this plasmid. To create the pSEA469B4CT, the Aspergillus niger (regulatory sequence) ("A4") promoter was operably linked to the structural gene encoding the 69B4 protease, and used to drive the expression of the protease.
- A4 Aspergillus niger
- a fusion between the A4-promoter and the Cel A was constructed by fusion- PCR techniques, as a Xbal-BamHl fragment.
- the fragment was ligated into plasmid pSE GCT digested with Xbal and BamHl, resulting in plasmid pSEA469B4CT (See, Figure 7).
- the sequence of the A4 (A niger) promoter region is:
- pXX-Kpnl is a pUC based vector with the aprE promoter (B. subtilis) driving expression, a cat gene, and a duplicate aprE promoter for amplification of the copy number in B. subtilis.
- the bla gene allows selective growth in E. coli.
- the Kpn introduced in the ribosomal binding site, downstream of the aprE promoter region, together with the Hindl site enables cloning of Asp expression cassettes in pXX- Kpnl.
- the vector p2JM103-DNNDPI contains the aprE promoter (B. subtilis) to drive expression of the BCE103 cellulase core (endo-cellulase from an obligatory alkaliphilic Bacillus; See, Shaw etal., J. Mol.
- ASP When secreted, ASP is cleaved of the cellulase core to turn into the mature protease pHPLT (See, Figure 17; and Solingen et al., Extremophiles 5:333-341 [2001]) contains the thermostable amylase LAT promoter (P LAT ) of Bacillus licheniformis, followed by Xbal and Hpal restriction sites for cloning ASP expression constructs.
- P LAT thermostable amylase LAT promoter
- the following sequence is that of the BCE103 cellulase core with DNNDPI acid labile linker. In this sequence, the bold indicates the acid-labile linker, while the standard font indicates the BCE103core.
- the Asp expression cassettes were cloned in the pXX-Kpnl vector containing DNA encoding the wild type Asp signal peptide, or a hybrid signal peptide constructed of 5 subtilisin AprE N-terminal signal peptide amino acids fused to the 25 Asp C-terminal signal peptide amino acids (MRSKKRTVTRALAVATAAATLLAGGMAAQA (SEQ ID NO:135), or a hybrid signal peptide constructed of 11 subtilisin AprE N-terminal signal peptide amino acids fused to the 19 asp C-terminal signal peptide amino acids
- Primers were obtained from MWG and Invitrogen. Invitrogen Platinum Taq DNA polymerase High Fidelity (Cat.No. 11304-029) was used for PCR amplification (0.2 ⁇ M primers, 25 up to 30 cycles) according to the Invitrogen's protocol. Ligase reactions of ASP expression cassettes and host vectors were completed by using Invitrogen T4 DNA Ligase (Cat. No. 15224-025), utilizing Invitrogen's protocol as recommended for general cloning of cohesive ends). Selective growth of B.
- Invitrogen Platinum Taq DNA polymerase High Fidelity Cat.No. 11304-029
- Ligase reactions of ASP expression cassettes and host vectors were completed by using Invitrogen T4 DNA Ligase (Cat. No. 15224-025), utilizing Invitrogen's protocol as recommended for general cloning of cohesive ends). Selective growth of B.
- subtilis (AaprE, AnprE, oppA, AspollE, degUHy32, AamyE::(xylR,pxylA-comK) transformants harboring the p2JM103-ASP vector or one of the pHPLT-ASP vectors was performed in shake flasks containing 25 ml Synthetic Maxatase Medium (SMM), with 0.97 g/l CaCI 2 .6H 2 O instead of 0.5 g/l CaCI 2 (See, U.S. Pat. No. 5,324,653, herein incorporated by reference) with either 25 mg/L chloramphenicol or 20 mg/L neomycin.
- SMM Synthetic Maxatase Medium
- the impact of the synthetic asp gene was investigated in Bacillus subtilis comparing the expression levels of the pHPLT-ASP-c-1-2 construct with the synthetic and native asp gene in a B. subtilis (AaprE, AnprE, oppA, AspollE, degUHy32, AamyE::(xylR,pxylA-comK) strain.
- the native gene was amplified from plasmid containing the native asp gene, using platinum pfx polymerase (Invitrogen) with the following primers:
- AK04-11 RBS thru 5 aa aprE for ASP native C1 fusion in pHPLT taaagagtgagaagcaaaaacgcacagtcacgcgggccctg (SEQ ID NO:166)
- AK04-13 Hpal 3' of native ASP mature gtcctctgttaacttacgggctgctgcccgagtcc (SEQ ID NO:167)
- subtilis (AaprE, AnprE, oppA, AspollE, degUHy32, AamyE::(xylR,pxylA- comK). Transformation to B. subtilis was performed as described in WO 02/14490 A2, herein incorporated by reference.
- the Asp protein was produced by growth in shake flasks at 37°C in medium containing the following ingredients; 0.03 g/L MgSO4, 0.22 g/L K2HPO4, 21.3 g/L
- PCR conditions were used to amplify both pieces: 94 ° C for 2 min. ; followed by 30 cycles of 94°C for 30 sec, 50°C for 1 min., and 66°C for 1 min. ; followed by 72°C for 7 min.
- the resulting PCR products were run on an E-gel (Invitrogen), excised, and purified with a gel extraction kit (Qiagen).
- a PCR overlap extension fusion Ho, Gene, 15:51-59 [1989] was used to fuse the above gene fragment to the sacB promoter-aprE signal peptide fragment with PFX polymerase (Invitrogen) using the following primers:
- the purified fusions were cut (EcoRI/r// ⁇ dlll) and ligated (T4 DNA Ligase, NEB) into an EcoRI/r//ndlll pJH101 (Ferrari et al., J. Bacteriol., 152:809-814 [1983]) vector containing a strong transcriptional terminator.
- the ligation mixture was transformed into competent E. coli cells (Top 10 chemically competent cells, Invitrogen) and plasmid preps were done to retrieve the plasmid (Qiagen spin-prep).
- the plasmid, pJHsacB-ASP (1-96 sacB promoter; 97-395 aprE+1 through end of aprE ss; and 396-1472 pro+mature asp; See, sequence provided below) was transformed to B. subtilis . Transformation to B. subtilis (AaprE, AnprE, oppA, AspollE, degUHy32, AamyE::(xylR,pxylA-comK) strain was performed as described in WO 02/14490 A2, herein incorporated by reference. The chromosomal DNA was extracted from an overnight culture of the strain (grown in LB media) then transformed to strain BG 3594 and named "CF 202.” This strain produced a clear halo on the indicator plate (LA + 1.6% skim milk).
- the plasmid pHPLT-ASP-C1-2 (See, Table 10-2, and Figure 9), was transformed into B. subtilis (AaprE, AnprE, Aepr, AispA, Abpr, Avpr, AwprA,Ampr-ybfJ, AnprB) and (degU Hy 32, oppA, AspollE3501, amyE:(xylRPxylAcomK-ermC). Transformation was performed as known in the art (See e.g., WO 02/14490, incorporated herein by reference).
- the Asp protein was produced by growth in shake flasks at 37°C in MBD medium, a MOPS based defined medium.
- MBD medium was made essentially as known in the art (See, Neidhardt etal., J. Bacteriol., 119: 736-747 [1974]), except NH4CI2, FeSO4, and CaCI2 were left out of the base medium, 3 mM K2HPO4 was used, and the base medium was supplemented with 60 mM urea, 75 g/L glucose, and 1 % soytone.
- micronutrients were made up as a 100 X stock containing in one liter, 400 mg FeSO4 .7H2O, 100 mg MnSO4 .H2O, 100 mg ZnSO4.7H2O, 50 mg CuCI2.2H2O, 100 mg CoCI2.6H2O, 100 mg NaMoO4.2H2O, 100 mg Na2B4O7.10H2O, 10 ml of 1 M CaCI2 , and 10 ml of 0.5 M sodium citrate. The expression levels obtained in these experiments were found to be fairly high.
- "consensus" promoters such as those developed through site-saturation mutagenesis to create promoters that more perfectly conform to the established consensus sequences for the "-10" and “-35" regions of the vegetative "sigma A- type” promoters for B. subtilis (See, Voskuil et al., Mol. Microbiol., 17:271-279 [1995]) find use in the present invention.
- the present invention be limited to any particular consensus promoter, as it is contemplated that other promoters that function in Bacillus cells will find use in the present invention.
- clausii PB92 MAXACAL ® protease
- MXL-prom SEQ ID NOS:173, 174, and 175, See, Figure 18
- signal sequences leader sequences are known to be very important for secreting proteins in B. clausii.
- B. clau-3F agggaaccgaatgaagaaacgaactgtcacaagagctctg (SEQ ID NO: 176)
- B. clau-3R cagagctcttgtgacagttcgtttcttcattcggttccct (SEQ ID NO: 177)
- B. clau-6F aatgaagaaaccgttggggcgaactgtcacaagagctctg (SEQ ID NO: 178)
- clau-6R cagagctcttgtgacagttcgcccaacggtttcttcatt (SEQ ID NO: 179)
- clau-27F agttcatcgatcgcatcggctaacgaaccggctcctccagga (SEQ ID NO:180)
- B. clau-27R tcctggaggagccggttcgttagccgatgcgatcgatgaact (SEQ ID NO:181)
- B. clau-vector 5' tcaqqqqqatcctaqattctqtttaacttaacqtt.
- This primer contains the Hpal-site (GTTAAC) from the promoter region and a SamHI-site (GGATCC) for cloning reasons (both underlined).
- pHPLT-H/ndlll-R gtgctgttttatcctttaccttgtctcc (SEQ ID NO:183).
- the sequence of this primer lays just upstream of the H/n /lll-site of pHPLT-ASP-C1-2 (See, TablelO- 2).
- pMAX4 refers to the template described in WO 88/06623, herein incorporated by reference.
- PCR fragments 3F3R, 6F6R, 27F27R were digested with both BamHl and Hindlll.
- the digested PCR fragments were ligated with T4 ligase (Invitrogen) into BamHl + Hindlll-opened plasmid pHPLT-ASP-C1-2 (See, Figure 18).
- T4 ligase Invitrogen
- subtilis cells ((AaprE, AnprE, oppA, AspollE, degUHy32, AamyE::(xylR,pxylA-comK; See e.g., WO 02/14490, incorporated herein by reference) and selected on neomycin (20 mg/l). Heart Infusion-agar plates containing neomycin were used to identify neomycin resistant colonies. DNA of the B. subtilis transformants was isolated using Qiagen's plasmid isolation kit according to manufacture's instructions, and were tested on the appearance of the fused MAXACAL® protease-Asp fragment by their pattern after digestion with both Ncol + Hpal together in one tube.
- the restriction enzymes used in this Example i.e., BamHl, Hindlll, Ncol and Hpal
- BamHl, Hindlll, Ncol and Hpal were all purchased from ⁇ EB, and used following the instructions of the supplier.
- D ⁇ A of B. subtilis transformants that showed 2 bands with restriction enzymes was used to transform protease negative B. clausii stra n PBT142 protoplast cells (these were derived from PB92).
- the protoplast transformation of B. clausii strain PBT142 was performed according to the protocol mentioned for the protoplast transformation of B. alkalophilus (renamed B.
- B. clausii PBT142 Transformants in B. clausii PBT142 were selected by replica-plating on Heart Infusion agar plates containing 20 mg/l neomycin. The B. clausii strains with the different construct were produced as indicated in Table 11-2.
- chromosome is described in several publications (See e.g., WO 88/06623, and Van der Laan etal., supra). The procedure described in patent WO 88/06623 for integration of 1 or 2 copies of the MAXACAL® protease gene in the chromosome of B. alcalophilus (now, B. clausii) was used to integrate at least 1 copy of the asp gene in the chromosome of B. clausii PBT142.
- pE194-neo a derivative of pE194-neo: pENM#3 (See, Figure 19) was used instead of the integration vector pE194-neo (to make pMAX4 containing the MAXACAL® protease gene).
- the Asp leader PCR product 27F27R was cloned in the unique blunt end site Hpal in between the 5' and the 3' flanking regions of the MAXACAL® protease gene. Therefore, 27F27R was made blunt-ended as follows: it was first digested with Hpal (5'end), purified with the Qiagen PCR purification kit, and then digested with Hindlll (3'end).
- This treated PCR fragment 27F27R was purified again after Hindlll digestion (using the same Qiagen kit) and filled in with dNTP's using T4 polymerase (Invitrogen) and purified again with Qiagen kit.
- the -pal-opened pENM#3 and the blunt- ended PCR product 27F27R were ligated with T4 ligase (Invitrogen).
- the ligation product was transformed directly to B. clausii PBT142 protoplasts and selected after replica-plating on HI agar plates with 20 mg/l neomycin. Two transformants with the correct orientation of the asp gene in the integration vector were identified and taken into the integration procedure as described in patent WO 88/06623.
- Plasmid pHPLT (See, Figure 17; and U.S. Pat. No. 6,562,612 [herein incorporated by reference) is a pUB110 derivative, has a neomycin resistance marker for selection, and contains the B. licheniformis -amylase (LAT) promoter (P LA T), a sequence encoding the LAT signal peptide (preLAT), followed by Ps ⁇ and Hpal restriction sites for cloning and the LAT transcription terminator.
- the plCatH vector (See, Figure 20) contains a temperature sensitive origin of replication (ori pE194, for replication in Bacillus), ori pBR322 (for amplification in E.
- Construct ASPd was created as a Psft-Hpal fragment by fusion PCR with High
- fusionC1_FW CATTGAAAGGGGAGGAGAATCATGAGAAGCAAGAAGCGAACTGTCAC (SEQ ID NO:185)
- pHPLT-H/ndllLRV CTTTACCTTGTCTCCAAGCTTAAAATAAAAAAACGG (SEQ ID NO: 187)
- PCR reactions were typically performed on a thermocycler for 30 cycles with High Fidelity Platinum Taq polymerase (Invitrogen) according to the manufacturer's instructions, with annealing temperature of 55°C.
- PCR-I was performed with the primers pHPLT-Bglll_FW and fusionC1_RV on pHPLT as template DNA.
- PCR-II was performed with primers fusionC1_FW and pHPLTHindlll_RV on plasmid pHPLT-ASP-C1-2.
- the fragments from PCR-I and PCR-II were assembled in a fusion PCR with the primers pHPLT-Bglll_FW and pHPLT-Hindlll_RV.
- This final PCR fragment was purified using the Qiagen PCR purification kit, digested with Bglll and Hindlll, and ligated with T4 DNA ligase according to the manufacturers' instructions into Bglll and Hindlll digested pHPLT.
- the ligation mixture was transformed into B. subtilis strain OS14 as known in the art (See, U.S. Pat. Appl. No. US20020182734 and WO 02/14490, both of which are incorporated herein by reference). Correct transformants produced a halo on a skimmed milk plate and one of them was selected to isolate plasmid pHPLT-ASPd . This plasmid was introduced into B.
- B. licheniformis host BML780 (BRA7 derivative, cat-, amyL-, spo-, aprL-, endoGluC-) by protoplast transformation as known in the art (See, Pragai et al., Microbiol., 140:305-310 [1994]).
- Neomycin resistant transformants formed halos on skim plates, whereas the parent strain without pHPLT-ASPd did not.
- This result shows that B. licheniformis is capable of expressing and secreting ASP protease when expression is driven by the LAT promoter and when it is fused to a hybrid signal peptide (MRSKKRTVTRALAVATAAATLLAGGMAAQA; SEQ ID NO:135).
- Construct ASPc3 was created as a Psx ⁇ -Hpal fragment by fusion PCR (necessary to remove the internal Psfl site in the synthetic asp gene) as described above with the following primers:
- Plasmid pHPLT-ASPc3 was isolated from a neomycin resistant that formed a relatively (compared to other transformants) large halo on a skim milk plate. Plasmid DNA was isolated using the Qiagen plasmid purification kit and sequenced by BaseClear. Sequencing confirmed that the ASPc3 construct encodes mature ASP that has two aspartic acid residues at the extreme C-terminal end (S188D, P189D).
- pHPLT-ASPc3 was transformed into BML780 as described above.
- BML780(pHLPT-ASPc3) produced a halo on a skim milk plate indicating that also this ASPc3 construct leads to ASP expression in B. licheniformis.
- the C3 construct was amplified from pHPLT-ASPc3 with the following primers:
- the PCR product was digested with Xhol, ligated into Xh ⁇ l-digested plCatH (See, Figure 20) and transformed into B. subtilis OS14 as described above.
- the plasmid from an ASP expressing clone was isolated and designated plCatH-ASPc3.
- DNA sequencing by BaseClear confirmed that no further mutations were introduced in the ASPc3 cassette in plCatH-ASPC3.
- the plasmid was then transformed into BML780 at the permissive temperature (37 °C) and one neomycin resistant (neoR) and chloramphenicol resistant (capR) transformant were selected and designated BML780(plCatH-ASPc3).
- the plasmid in BML780(plCatH-ASPc3) was integrated into the cat region on the B. licheniformis genome by growing the strain at a non-permissive temperature (50 °C) in medium with chloramphenicol.
- One capR resistant clone was selected and designated BML780-plCatH-ASPc3.
- BML780-plCatH-ASPc3 was grown again at the permissive temperature for several generations without antibiotics to loop-out vector sequences and then one neomycin sensitive (neoS), capR clone was selected.
- vector sequences of plCatH on the chromosome were excised (including the neomycin resistance gene) and only the ASPc3-cat cassette was left.
- the cat gene is a native B. licheniformis gene and that the asp gene is the only heterologous piece of DNA introduced into the host.
- the ASPc3-cat cassette on the chromosome was amplified by growing the strain in/on media with increasing concentrations of chloramphenicol. After various rounds of amplification, one clone (resistant against 75 ⁇ g/ml chloramphenicol) was selected and designated "BML780-ASPc3.” This clone produced a clear halo on a skim milk plate, whereas the parental strain BML780 did not, indicating that ASP protease is produced and secreted by the BML780-ASPc3 strain.
- Construct ASPc4 is similar to ASPc3, but ASP protease expressed from ASPc4 does not have two aspartic acid residues at the C-terminal end of the mature chain.
- ASPc4 was created by amplification of the asp gene in pHPLT-ASPc3 with the following Hypur primers from MWG Biotech (Germany):
- the ASPc4 PCR product was purified and digested with Xhol, ligated into Xhol- digested plCatH, and transformed into B. subtilis OS14 as described above for ASPc3. Plasmid was isolated from a neoR, capR clone and designated plCatH-ASPc4. plCatH- ASPc4 was transformed into BML780, integrated in the genome, vector sequences were excised, and the cat-ASPc4 cassette was amplified as described above for the ASPc3 construct.
- the ASPc5 PCR product was purified and digested with Xho , ligated into Xhol digested plCatH, and transformed into B. subtilis OS14 as described above for ASPc3. Plasmid was isolated from a neoR, capR clone and designated "pICatH-ASPc ⁇ .” DNA sequencing confirmed that no unwanted mutations were introduced into the asp gene by the PCR. pICatH-ASPc ⁇ was transformed into BML780, integrated in the genome, vector sequences were excised, and the cat-ASPc5 cassette was amplified as described above for the ASPc3 construct. It was observed that B.
- construct ASPc6 has the B. licheniformis subtilisin (aprL) promoter, RBS and signal peptide sequence fused in-frame to the DNA sequence encoding mature ASP from the optimized DNA2.0 gene. It was created by a fusion PCR with primer ASPendTERMXhoLRV and the following primers:
- PCR-I was performed with the primers AprLupXhoLFW and AprLAsp_RV on chromosomal DNA of BRA7 as template DNA.
- PCR-II was performed with primers AprLAsp_FW and ASPendTERMXhoLRV on the synthetic asp gene of DNA2.0.
- the fragments from PCR-I and PCR-II were assembled in a fusion PCR with the primers ASPendTERMXhoLRV and AprLupXhoLFW. This final PCR fragment was purified using Qiagen's PCR purification kit (according to the manufacturer's instructions), digested with Xhol, ligated into plCatH, and transformed into B. subtilis OS14, as described above for ASPc3.
- Plasmid was isolated from a neoR, capR clone and designated "pICatH-ASPc ⁇ .” DNA sequencing confirmed that no unwanted mutations were introduced into the asp gene or aprL region by the PCRs.
- pICatH-ASPc6 was transformed into BML780, integrated in the genome, vector sequences were excised, and the cat-ASPc6 cassette was amplified as described above for the ASPc3 construct.
- B. licheniformis strains with the ASPc6 construct also formed halos on skim milk plates, indicating that the aprL promoter in combination with the AprL signal peptide drives expression/secretion of ASP protease in B. licheniformis.
- primer pairs were used to PCR (in the presence of 10% DMSO), the different fragments from the chromosomal DNA K25.10, carrying the ASP gene and introduced Spel-Ascl sites to clone the fragments into the vector pTREX4 (See, Figure 21) digested with Spel and Ascl restriction enzymes.
- AspproF forward primer (Spel-Kexin site-ATG-pro sequence): 5'-ACTAGTAAGCGGATGAACGAGCCCGCACCACCCGGGAGCGCGAGC (SEQ ID NO:200)
- AspproR reverse primer (Ascl site; C-term pro region from the TAA stop codon to the end of the gene): 5'- GGCGCGCC TTA GGGGAGGGTGAGCCCCATGGTGTAGGCACCG (SEQ ID NO:201)
- the ASP 5'pro region and mature gene AspproF forward primer (Spel-Kexin site-ATG-pro sequence): 5'-ACTAGTAAGCGGATGAACGAGCCCGCACCACCCGGGAGCGCGAGC (SEQ ID NO:202) AspmatR reverse primer (Ascl site: TAA stop to the end of the mature sequence) 5'- GGCGCGCC TTA CGGGCTGCTGCCCGAGTCCGTGGTGATCA-3' (SEQ ID NO:203)
- AspmatR Reverse Primer (Ascl site: TAA stop to end of mature sequence) 5'- GGCGCGCC TTA CGGGCTGCTGCCCGAGTCCGTGGTGATCA-3' (SEQ IDs NO:205)
- the different plasmids were transformed into a Trichoderma reesei strain with disruptions in the cbhl, cbh2, egll, and eg/2 genes, using biolistic transformation methods known in the art.
- Stable transformants were screened, based on morphology. Ten0 stable transformants for each construct were screened in shake flasks.
- the initial inoculum media used contained 30g/L ⁇ -lactose, 6.5g/L (NH 4 ) 2 SO 4 , 2g/L KH 2 PO 4 , 0.3g/L MgSO 4 *7H 2 O, 0.2g/L CACI 2 , 1ml/L 1000X T. reesei Trace Salts, 2 mL/L 10% TWEEN®-80, 22.5 g/L Proflo, and 0.72g/L CaCO 3 , in which the transformants were grown for approximately 48 hr. After this incubation period, 10% of the culture was transferred into5 flasks containing minimal medium known in the art (See, Foreman etal., J. Biol.
- EXAMPLE 14 Protease Production in A. nigero
- experiments conducted to produce protease 69B4 in Aspergillus niger var. awamori are described.
- four different fungal constructs (fungal expression vectors comprising glaA fusions) were developed.
- the third contained the ASP 5' pro-region, mature gene, and the 3' pro-region;
- primers were used to PCR (in the presence of 10% DMSO) the different fragments from the chromosomal DNA 69B4 carrying the asp gene and introduced the Nhe 1-BstBl sites to clone the fragments into the vector pSLGAMpR2 (See, Figure 22) digested with Nhel and BstEll restriction enzymes.
- Primers Anforward 01 and Anforward 02 contained attB1 Gateway cloning sequences (Invitrogen) at the 5' end of the primer.
- Primers Anreversed 01 and Anreversed 02 contained attB2 Gateway cloning sequences (Invitrogen) at the 5' end of the primer.
- Anreversed 02 (without the attB1 sequence) 5'- GGGGAGGGTGAGTCCCATTGTGTAAGCTCCTGA-3' (SEQ ID NO:209)
- PCR conditions were as follows: 5 ⁇ L of 10X PCR reaction buffer (Invitrogen); 20 mM MgSO 4 ; 0.2 mM each of dATP, dTTP, dGTP, dCTP (final concentration), 1 ⁇ L of 10 ng/ ⁇ L genomic DNA, 1 ⁇ L of High Fidelity Tag polymerase (Invitrogen) at 1 unit per ⁇ L, 0.2 ⁇ M of each primer (final concentration), 5 ⁇ l DMSO and water to 50 ⁇ L.
- 10X PCR reaction buffer Invitrogen
- 20 mM MgSO 4 20 mM MgSO 4 ; 0.2 mM each of dATP, dTTP, dGTP, dCTP (final concentration), 1 ⁇ L of 10 ng/ ⁇ L genomic DNA, 1 ⁇ L of High Fidelity Tag polymerase (Invitrogen) at 1 unit per ⁇ L, 0.2 ⁇ M of each primer (final concentration), 5 ⁇ l DMSO and water to 50
- the PCR protocol was: 94 ° C for 5 min.; followed by 30 cycles of 94 ° C for 30 sec, 55 ° C for 30 sec, and 68 ° C for 3 min; followed by 68 ° C for 10 min., and 15 ° C for 1 min.
- the different plasmids and a helper plasmid were transformed into Aspergillus niger var awamori (Delta Ap4 strain), using protoplast transformation methods known in the art.
- Stable transformants were screened, based on morphology. Ten stable transformants for each construct were screened in shake flasks.
- a piece of agar containing the strain was transferred into flasks containing RoboSoy medium or the formula 12 g/l Tryptone, 8 g/l Soytone, 15 g/l Ammonium sulfate, 12.1 g/l NaH 2 PO 4 .H 2 O, 2.19 g/l Na 2 HPO 4 , 5 ml 20% MgSO4.7H2O, 10 ml 10% Tween 80, 500 ml 30% Maltose and 50 ml 1 M phosphate buffer pH 5.8 and 2 g/l uridine to induce expression.
- the flasks were placed in a 28 ° C shaker.
- This vector containing the Asp expression cassette composed of the synthetic DNA sequence (See, Example 10) encoding the Asp hybrid Signal peptide and the Asp N-terminal pro and mature protein were found to enable expression of the protein indicated below (the signal peptide and precursor protease) and secretion of the mature Asp protease.
- the signal peptide and precursor protease are provided in the following sequence (SEQ ID NO:214) (in this sequence, bold indicates the mature protease, underlining indicates the N- terminal prosequence, and the standard font indicates the signal peptide):
- Construction of each SSM library started with two PCR amplifications using pHPLT-Bglll-FW primer and a specific Reverse mutagenesis primer, and pHPLT-Bglll-RV primer and a specific Forward mutagenesis primer (equal positions for the mutagenesis primers).
- Platinum Tag DNA polymerase High Fidelity (Cat.No. 11304- 029; Invitrogen) was used for PCR amplification (0.2 ⁇ M primers, 20 up to 30 cycles) according to protocol provided by Invitrogen. Briefly, 1 ⁇ L amplified DNA fragment of both specific PCR mixes, both targeted the same codon, was added to 48 ⁇ L of fresh PCR reaction solution together with primers pHPLT-Bglll-FW and pHPLT-Bglll-RV. This fusion PCR amplification (22 cycles) resulted in a linear pHPLT-ASP-d-2 DNA fragment with a specific Asp mature codon randomly mutated and a unique Bglll restriction site on both ends. Purification of this DNA fragment (Qiagen PCR purification kit, Cat.No. 28106), digesting it with Bglll, performing an additional purification step and a ligation reaction
- each library After overnight incubation at 37°C, 96 single colonies were picked from Heart Infusion agar plates with 20 mg/L neomycin and grown for 4 days at 37°C in MOPS media with 20 mg/ml neomycin and 1.25 g/L yeast extract (See, WO 03/062380, incorporated herein by reference, for the exact medium formulation used herein) for sequence analysis (BaseClear) and protease expression for screening purposes.
- the library numbers ranged from 1 up to 189, with each number representing the codon of the mature asp sequence that is randomly mutated. After selection, each library included a maximum of 20 Asp protease variants.
- GGCAACGCATATACTATTNNSGGCCGGTCTAGATGTTCT asp12F (SEQ ID NO:228) AACGCATATACTATTGGCNNSCGGTCTAGATGTTCTATC asp13F (SEQ ID NO:229)
- GCATATACTATTGGCGGCNNSTCTAGATGTTCTATCGGA asp14F (SEQ ID NO:230) TATACTATTGGCGGCCGGNNSAGATGTTCTATCGGATTC asp15F (SEQ ID NO:231)
- ACTATTGGCGGCCGGTCTNNSTGTTCTATCGGATTCGCA asp16F (SEQ ID NO:232) ATTGGCGGCCGGTCTAGANNSTCTATCGGATTCGCAGTA asp17F (SEQ ID NO:233)
- GGCGGCCGGTCTAGATGTNNSATCGGATTCGCAGTAAAC asp18F (SEQ ID NO:234)
- GGCCGGTCTAGATGTTCTNNSGGATTCGCAGTAAACGGT asp19F (SEQ ID
- EXAMPLE 16 Construction of Arginine and Cysteine Combinatorial Mutants In this Example, the construction of multiple arginine and cysteine mutants of ASP is described. These experiments were conducted in order to determine whether the use of surface arginine and cysteine combinatorial libraries would lead to mutants with increased expression at the protein level.
- the QuikChange® multi site-directed mutagenesis (QCMS) kit (Stratagene) was used to construct the two libraries.
- the 5' phosphorylated primers used to create the two libraries are shown in Table 16-1. It was noted that HPLC, PAGE or any other type of purified primers gave far better results in terms of incorporation of full length primers as well as significant reduction in primer-containing errors. However, in these experiments, purified primers were not used, probably resulting in the production of 12% of clones had undesired mutations.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Detergent Compositions (AREA)
- Fodder In General (AREA)
Abstract
Description
Claims
Priority Applications (14)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020067012183A KR101482015B1 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes, vectors incorporating them, and host cells |
BRPI0416797-0A BRPI0416797A (en) | 2003-11-19 | 2004-11-19 | serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating them |
KR1020137013997A KR20130083461A (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
JP2006541585A JP5244317B2 (en) | 2003-11-19 | 2004-11-19 | Serine protease, nucleic acid encoding serine enzyme, vector and host cell incorporating the same |
AU2004293826A AU2004293826B2 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
CA002546451A CA2546451A1 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
CN200480040520.XA CN1906303B (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
US10/576,331 US8535927B1 (en) | 2003-11-19 | 2004-11-19 | Micrococcineae serine protease polypeptides and compositions thereof |
EP04811731A EP1694847B1 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
DK04811731.1T DK1694847T3 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes, and vectors and host cells comprising these. |
US11/809,104 US7985569B2 (en) | 2003-11-19 | 2007-05-31 | Cellulomonas 69B4 serine protease variants |
US13/162,104 US8455234B2 (en) | 2003-11-19 | 2011-06-16 | Multiple mutation variants of serine protease |
US13/888,300 US8865449B2 (en) | 2003-11-19 | 2013-05-06 | Multiple mutation variants of serine protease |
US14/483,375 US20150072913A1 (en) | 2003-11-19 | 2014-09-11 | Multiple Mutation Variants of Serine Protease |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US52360903P | 2003-11-19 | 2003-11-19 | |
US60/523,609 | 2003-11-19 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/576,331 A-371-Of-International US8535927B1 (en) | 2003-11-19 | 2004-11-19 | Micrococcineae serine protease polypeptides and compositions thereof |
US58333406A Continuation-In-Part | 2003-11-19 | 2006-10-19 |
Publications (3)
Publication Number | Publication Date |
---|---|
WO2005052146A2 true WO2005052146A2 (en) | 2005-06-09 |
WO2005052146A3 WO2005052146A3 (en) | 2005-11-10 |
WO2005052146A8 WO2005052146A8 (en) | 2006-08-24 |
Family
ID=34632801
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2004/039006 WO2005052161A2 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
PCT/US2004/039066 WO2005052146A2 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2004/039006 WO2005052161A2 (en) | 2003-11-19 | 2004-11-19 | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same |
Country Status (10)
Country | Link |
---|---|
US (1) | US8535927B1 (en) |
EP (1) | EP1694847B1 (en) |
JP (1) | JP5244317B2 (en) |
KR (2) | KR101482015B1 (en) |
CN (2) | CN103421760A (en) |
AU (2) | AU2004293826B2 (en) |
BR (1) | BRPI0416797A (en) |
CA (1) | CA2546451A1 (en) |
DK (1) | DK1694847T3 (en) |
WO (2) | WO2005052161A2 (en) |
Cited By (471)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008048392A1 (en) * | 2006-10-19 | 2008-04-24 | Danisco Us, Inc., Genencor Division | Multiple mutation variants of serine protease |
WO2008153934A2 (en) * | 2007-06-06 | 2008-12-18 | Danisco Us, Inc., Genencor Division | Methods for improving protein performance |
WO2009058679A1 (en) | 2007-10-30 | 2009-05-07 | Danisco Us Inc., Genencor Division | Streptomyces protease |
EP2100949A1 (en) | 2008-03-14 | 2009-09-16 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP2166075A1 (en) | 2008-09-23 | 2010-03-24 | The Procter and Gamble Company | Cleaning composition |
EP2166092A1 (en) | 2008-09-18 | 2010-03-24 | The Procter and Gamble Company | Detergent composition |
EP2166073A1 (en) | 2008-09-23 | 2010-03-24 | The Procter & Gamble Company | Cleaning composition |
JP2010519894A (en) * | 2007-03-01 | 2010-06-10 | ノボ・ノルデイスク・エー/エス | Protein expression in E. coli |
EP2213713A1 (en) | 2009-02-02 | 2010-08-04 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2213714A1 (en) | 2009-02-02 | 2010-08-04 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2213715A1 (en) | 2009-02-02 | 2010-08-04 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088163A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088161A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088164A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2216393A1 (en) | 2009-02-09 | 2010-08-11 | The Procter & Gamble Company | Detergent composition |
WO2011005905A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | A mildly alkaline, low-built, solid fabric treatment detergent composition comprising phthalimido peroxy caproic acid |
WO2011005911A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | Method of laundering fabric using a compacted liquid laundry detergent composition |
WO2011005730A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | A catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte |
WO2011005917A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | Method of laundering fabric using a liquid laundry detergent composition |
WO2011005913A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | A catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte |
WO2011005804A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | Method of laundering fabric using a liquid laundry detergent composition |
WO2011025615A2 (en) | 2009-08-13 | 2011-03-03 | The Procter & Gamble Company | Method of laundering fabrics at low temperature |
WO2011072017A2 (en) | 2009-12-10 | 2011-06-16 | The Procter & Gamble Company | Detergent composition |
WO2011071997A1 (en) | 2009-12-10 | 2011-06-16 | The Procter & Gamble Company | Automatic dishwashing product and use thereof |
WO2011072117A1 (en) | 2009-12-09 | 2011-06-16 | The Procter & Gamble Company | Fabric and home care products |
WO2011071994A2 (en) | 2009-12-10 | 2011-06-16 | The Procter & Gamble Company | Detergent composition |
WO2011084319A1 (en) | 2009-12-10 | 2011-07-14 | The Procter & Gamble Company | Detergent composition |
EP2345599A1 (en) | 2008-02-08 | 2011-07-20 | The Procter & Gamble Company | Water-soluble pouch |
EP2357220A1 (en) | 2010-02-10 | 2011-08-17 | The Procter & Gamble Company | Cleaning composition comprising amylase variants with high stability in the presence of a chelating agent |
WO2011098531A1 (en) | 2010-02-10 | 2011-08-18 | Novozymes A/S | Variants and compositions comprising variants with high stability in presence of a chelating agent |
WO2011100667A1 (en) | 2010-02-14 | 2011-08-18 | Ls9, Inc. | Surfactant and cleaning compositions comprising microbially produced branched fatty alcohols |
EP2361964A1 (en) | 2010-02-25 | 2011-08-31 | The Procter & Gamble Company | Detergent composition |
EP2363456A1 (en) | 2010-03-01 | 2011-09-07 | The Procter & Gamble Company | Solid laundry detergent composition comprising brightener in micronized particulate form |
WO2011109316A1 (en) | 2010-03-01 | 2011-09-09 | The Procter & Gamble Company | Solid laundry detergent composition having an excellent anti-encrustation profile |
WO2011109318A1 (en) | 2010-03-01 | 2011-09-09 | 1/3The Procter & Gamble Company | Solid laundry detergent composition comprising c.i. fluorescent brightener 260 in alpha-crystalline form |
WO2011109320A1 (en) | 2010-03-01 | 2011-09-09 | The Procter & Gamble Company | Solid laundry detergent composition comprising secondary alcohol - based detersive surfactant |
EP2377914A1 (en) | 2010-04-19 | 2011-10-19 | The Procter & Gamble Company | Mildly alkaline, low-built, solid fabric treatment detergent composition comprising perhydrolase |
EP2380963A1 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Method of perfuming |
EP2380962A1 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Particle |
EP2380961A1 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Detergent composition |
EP2380481A2 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Automatic dishwashing product |
EP2380957A1 (en) | 2010-04-19 | 2011-10-26 | The Procter & Gamble Company | Solid laundry detergent composition having a dynamic in-wash ph profile |
WO2011133462A1 (en) | 2010-04-23 | 2011-10-27 | The Procter & Gamble Company | Particle |
WO2011133371A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | Method of laundering fabric using a compacted liquid laundry detergent composition |
WO2011133456A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | A liquid laundry detergent composition comprising a source of peracid and having a ph profile that is controlled with respect to the pka of the source of peracid |
WO2011133380A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | A laundry detergent composition comprising bleach particles that are suspended within a continuous liquid phase |
WO2011133372A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | Detergent composition |
EP2395071A1 (en) | 2010-06-10 | 2011-12-14 | The Procter & Gamble Company | Solid detergent composition comprising lipase of bacterial origin |
EP2395070A1 (en) | 2010-06-10 | 2011-12-14 | The Procter & Gamble Company | Liquid laundry detergent composition comprising lipase of bacterial origin |
WO2011163457A1 (en) | 2010-06-23 | 2011-12-29 | The Procter & Gamble Company | Product for pre-treatment and laundering of stained fabric |
EP2412792A1 (en) | 2010-07-29 | 2012-02-01 | The Procter & Gamble Company | Liquid detergent composition |
WO2012016104A2 (en) | 2010-07-29 | 2012-02-02 | The Procter & Gamble Company | Liquid detergent composition |
WO2012151534A1 (en) | 2011-05-05 | 2012-11-08 | Danisco Us Inc. | Compositions and methods comprising serine protease variants |
WO2012151480A2 (en) | 2011-05-05 | 2012-11-08 | The Procter & Gamble Company | Compositions and methods comprising serine protease variants |
EP2537918A1 (en) | 2011-06-20 | 2012-12-26 | The Procter & Gamble Company | Consumer products with lipase comprising coated particles |
WO2012177709A1 (en) | 2011-06-23 | 2012-12-27 | The Procter & Gamble Company | Product for pre-treatment and laundering of stained fabric |
EP2540824A1 (en) | 2011-06-30 | 2013-01-02 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants reference to a sequence listing |
WO2013006871A2 (en) | 2012-02-13 | 2013-01-10 | Milliken & Company | Laundry care compositions containing dyes |
EP2551336A1 (en) | 2011-07-25 | 2013-01-30 | The Procter & Gamble Company | Detergent compositions |
WO2013016031A1 (en) | 2011-07-27 | 2013-01-31 | The Procter & Gamble Company | Multiphase liquid detergent composition |
EP2584028A1 (en) | 2011-10-19 | 2013-04-24 | The Procter & Gamble Company | Particle |
WO2013110766A1 (en) | 2012-01-26 | 2013-08-01 | Novozymes A/S | Use of polypeptides having protease activity in animal feed and detergents |
EP2623586A2 (en) | 2012-02-03 | 2013-08-07 | The Procter & Gamble Company | Compositions and methods for surface treatment with lipases |
WO2013142495A1 (en) | 2012-03-19 | 2013-09-26 | Milliken & Company | Carboxylate dyes |
WO2013149858A1 (en) | 2012-04-02 | 2013-10-10 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2013171241A1 (en) | 2012-05-16 | 2013-11-21 | Novozymes A/S | Compositions comprising lipase and methods of use thereof |
EP2674476A1 (en) | 2012-06-11 | 2013-12-18 | The Procter & Gamble Company | Detergent composition |
WO2013189972A2 (en) | 2012-06-20 | 2013-12-27 | Novozymes A/S | Use of polypeptides having protease activity in animal feed and detergents |
WO2014009473A1 (en) | 2012-07-12 | 2014-01-16 | Novozymes A/S | Polypeptides having lipase activity and polynucleotides encoding same |
US8648015B2 (en) | 2006-06-23 | 2014-02-11 | Danisco Us Inc. | Systematic evaluation of sequence and activity relationships using site evaluation libraries for engineering multiple properties |
WO2014029819A1 (en) | 2012-08-22 | 2014-02-27 | Novozymes A/S | Metalloprotease from exiguobacterium |
WO2014029821A1 (en) | 2012-08-22 | 2014-02-27 | Novozymes A/S | Metalloproteases from alicyclobacillus sp. |
WO2014029820A1 (en) | 2012-08-22 | 2014-02-27 | Novozymes A/S | Detergent compositions comprising metalloproteases |
WO2014087011A1 (en) | 2012-12-07 | 2014-06-12 | Novozymes A/S | Preventing adhesion of bacteria |
WO2014100100A1 (en) | 2012-12-20 | 2014-06-26 | The Procter & Gamble Company | Detergent composition with silicate coated bleach |
WO2014096259A1 (en) | 2012-12-21 | 2014-06-26 | Novozymes A/S | Polypeptides having protease activiy and polynucleotides encoding same |
WO2014122161A2 (en) | 2013-02-06 | 2014-08-14 | Novozymes A/S | Polypeptides having protease activity |
WO2014138141A1 (en) | 2013-03-05 | 2014-09-12 | The Procter & Gamble Company | Mixed sugar compositions |
WO2014147127A1 (en) | 2013-03-21 | 2014-09-25 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2014160821A1 (en) | 2013-03-28 | 2014-10-02 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine, a soil release polymer, and a carboxymethylcellulose |
WO2014184164A1 (en) | 2013-05-14 | 2014-11-20 | Novozymes A/S | Detergent compositions |
WO2014183921A1 (en) | 2013-05-17 | 2014-11-20 | Novozymes A/S | Polypeptides having alpha amylase activity |
US20140345062A1 (en) * | 2013-05-23 | 2014-11-27 | Washing Systems, Llc | Method of laundering industrial garments |
EP2808372A1 (en) | 2013-05-28 | 2014-12-03 | The Procter and Gamble Company | Surface treatment compositions comprising photochromic dyes |
WO2014207227A1 (en) | 2013-06-27 | 2014-12-31 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
WO2014207224A1 (en) | 2013-06-27 | 2014-12-31 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
WO2015001017A2 (en) | 2013-07-04 | 2015-01-08 | Novozymes A/S | Polypeptides having anti-redeposition effect and polynucleotides encoding same |
WO2015004102A1 (en) | 2013-07-09 | 2015-01-15 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2015042086A1 (en) | 2013-09-18 | 2015-03-26 | The Procter & Gamble Company | Laundry care composition comprising carboxylate dye |
WO2015041887A2 (en) | 2013-09-18 | 2015-03-26 | Milliken & Company | Laundry care composition comprising carboxylate dye |
WO2015042087A1 (en) | 2013-09-18 | 2015-03-26 | The Procter & Gamble Company | Laundry care composition comprising carboxylate dye |
WO2015042209A1 (en) | 2013-09-18 | 2015-03-26 | The Procter & Gamble Company | Laundry care compositions containing thiophene azo carboxylate dyes |
EP2857487A1 (en) | 2013-10-07 | 2015-04-08 | WeylChem Switzerland AG | Multi-compartment pouch comprising cleaning compositions, washing process and use for washing and cleaning of textiles and dishes |
EP2857486A1 (en) | 2013-10-07 | 2015-04-08 | WeylChem Switzerland AG | Multi-compartment pouch comprising cleaning compositions, washing process and use for washing and cleaning of textiles and dishes |
EP2857485A1 (en) | 2013-10-07 | 2015-04-08 | WeylChem Switzerland AG | Multi-compartment pouch comprising alkanolamine-free cleaning compositions, washing process and use for washing and cleaning of textiles and dishes |
WO2015049370A1 (en) | 2013-10-03 | 2015-04-09 | Novozymes A/S | Detergent composition and use of detergent composition |
WO2015112340A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Method of treating textile fabrics |
WO2015112341A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Fabric treatment composition |
WO2015112339A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Fabric treatment composition |
WO2015112338A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Method of treating textile fabrics |
WO2015109972A1 (en) | 2014-01-22 | 2015-07-30 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2015130669A1 (en) | 2014-02-25 | 2015-09-03 | The Procter & Gamble Company | A process for making renewable surfactant intermediates and surfactants from fats and oils and products thereof |
WO2015130653A1 (en) | 2014-02-25 | 2015-09-03 | The Procter & Gamble Company | A process for making renewable surfactant intermediates and surfactants from fats and oils and products thereof |
WO2015134729A1 (en) | 2014-03-05 | 2015-09-11 | Novozymes A/S | Compositions and methods for improving properties of non-cellulosic textile materials with xyloglucan endotransglycosylase |
WO2015134737A1 (en) | 2014-03-05 | 2015-09-11 | Novozymes A/S | Compositions and methods for improving properties of cellulosic textile materials with xyloglucan endotransglycosylase |
EP2924105A1 (en) | 2014-03-28 | 2015-09-30 | The Procter and Gamble Company | Water soluble unit dose article |
EP2924106A1 (en) | 2014-03-28 | 2015-09-30 | The Procter and Gamble Company | Water soluble unit dose article |
WO2015148360A1 (en) | 2014-03-27 | 2015-10-01 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2015148361A1 (en) | 2014-03-27 | 2015-10-01 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2015150457A1 (en) | 2014-04-01 | 2015-10-08 | Novozymes A/S | Polypeptides having alpha amylase activity |
WO2015158237A1 (en) | 2014-04-15 | 2015-10-22 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2015171592A1 (en) | 2014-05-06 | 2015-11-12 | Milliken & Company | Laundry care compositions |
WO2015181119A2 (en) | 2014-05-27 | 2015-12-03 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2015187757A1 (en) | 2014-06-06 | 2015-12-10 | The Procter & Gamble Company | Detergent composition comprising polyalkyleneimine polymers |
WO2015189371A1 (en) | 2014-06-12 | 2015-12-17 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
WO2016044200A1 (en) | 2014-09-15 | 2016-03-24 | The Procter & Gamble Company | Detergent compositions containing salts of polyetheramines and polymeric acid |
WO2016048674A1 (en) | 2014-09-25 | 2016-03-31 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2016048969A1 (en) | 2014-09-25 | 2016-03-31 | The Procter & Gamble Company | Detergent compositions containing a polyetheramine and an anionic soil release polymer |
WO2016049387A1 (en) | 2014-09-26 | 2016-03-31 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2016069544A1 (en) * | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016081437A1 (en) | 2014-11-17 | 2016-05-26 | The Procter & Gamble Company | Benefit agent delivery compositions |
WO2016079110A2 (en) | 2014-11-19 | 2016-05-26 | Novozymes A/S | Use of enzyme for cleaning |
WO2016087401A1 (en) | 2014-12-05 | 2016-06-09 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2016096996A1 (en) | 2014-12-16 | 2016-06-23 | Novozymes A/S | Polypeptides having n-acetyl glucosamine oxidase activity |
WO2016069548A3 (en) * | 2014-10-27 | 2016-06-30 | Danisco Us Inc. | Serine proteases |
WO2016135351A1 (en) | 2015-06-30 | 2016-09-01 | Novozymes A/S | Laundry detergent composition, method for washing and use of composition |
US9434932B2 (en) | 2011-06-30 | 2016-09-06 | Novozymes A/S | Alpha-amylase variants |
EP3067410A2 (en) | 2008-02-15 | 2016-09-14 | The Procter and Gamble Company | Cleaning compositions |
WO2016162556A1 (en) | 2015-04-10 | 2016-10-13 | Novozymes A/S | Laundry method, use of dnase and detergent composition |
WO2016162558A1 (en) | 2015-04-10 | 2016-10-13 | Novozymes A/S | Detergent composition |
EP3088506A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Detergent composition |
EP3088503A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
EP3088502A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
EP3088504A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
EP3088505A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
WO2016178668A1 (en) | 2015-05-04 | 2016-11-10 | Milliken & Company | Leuco triphenylmethane colorants as bluing agents in laundry care compositions |
WO2016184944A1 (en) | 2015-05-19 | 2016-11-24 | Novozymes A/S | Odor reduction |
EP3101108A1 (en) | 2015-06-04 | 2016-12-07 | The Procter and Gamble Company | Hand dishwashing liquid detergent composition |
EP3101109A1 (en) | 2015-06-04 | 2016-12-07 | The Procter and Gamble Company | Hand dishwashing liquid detergent composition |
WO2016192905A1 (en) | 2015-06-02 | 2016-12-08 | Unilever Plc | Laundry detergent composition |
WO2016198262A1 (en) | 2015-06-11 | 2016-12-15 | Unilever Plc | Laundry detergent composition |
WO2016202739A1 (en) | 2015-06-16 | 2016-12-22 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2016202785A1 (en) | 2015-06-17 | 2016-12-22 | Novozymes A/S | Container |
US9528114B2 (en) | 2008-03-28 | 2016-12-27 | Danisco Us Inc. | Method for amplifying locus in bacterial cell |
WO2016206837A1 (en) | 2015-06-26 | 2016-12-29 | Unilever Plc | Laundry detergent composition |
WO2017046260A1 (en) | 2015-09-17 | 2017-03-23 | Novozymes A/S | Polypeptides having xanthan degrading activity and polynucleotides encoding same |
WO2017046232A1 (en) | 2015-09-17 | 2017-03-23 | Henkel Ag & Co. Kgaa | Detergent compositions comprising polypeptides having xanthan degrading activity |
WO2017060505A1 (en) | 2015-10-07 | 2017-04-13 | Novozymes A/S | Polypeptides |
WO2017064253A1 (en) | 2015-10-14 | 2017-04-20 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
WO2017066510A1 (en) | 2015-10-14 | 2017-04-20 | Novozymes A/S | Cleaning of water filtration membranes |
WO2017064269A1 (en) | 2015-10-14 | 2017-04-20 | Novozymes A/S | Polypeptide variants |
EP3173467A1 (en) | 2015-11-26 | 2017-05-31 | The Procter & Gamble Company | Cleaning compositions comprising enzymes |
WO2017089366A1 (en) | 2015-11-24 | 2017-06-01 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
WO2017093318A1 (en) | 2015-12-01 | 2017-06-08 | Novozymes A/S | Methods for producing lipases |
WO2017129754A1 (en) | 2016-01-29 | 2017-08-03 | Novozymes A/S | Beta-glucanase variants and polynucleotides encoding same |
US9725685B2 (en) | 2014-01-30 | 2017-08-08 | The Procter & Gamble Company | Unit dose article |
EP3205393A1 (en) | 2016-02-12 | 2017-08-16 | Basf Se | Process for preparation of microcapsules |
EP3205392A1 (en) | 2016-02-12 | 2017-08-16 | Basf Se | Microcapsules and process for preparation of microcapsules |
WO2017140391A1 (en) | 2016-02-17 | 2017-08-24 | Unilever Plc | Whitening composition |
WO2017140392A1 (en) | 2016-02-17 | 2017-08-24 | Unilever Plc | Whitening composition |
WO2017162378A1 (en) | 2016-03-21 | 2017-09-28 | Unilever Plc | Laundry detergent composition |
WO2017174769A2 (en) | 2016-04-08 | 2017-10-12 | Novozymes A/S | Detergent compositions and uses of the same |
WO2017174251A1 (en) | 2016-04-08 | 2017-10-12 | Unilever Plc | Laundry detergent composition |
WO2017182295A1 (en) | 2016-04-18 | 2017-10-26 | Basf Se | Liquid cleaning compositions |
WO2017186943A1 (en) | 2016-04-29 | 2017-11-02 | Novozymes A/S | Detergent compositions and uses thereof |
WO2017220422A1 (en) | 2016-06-23 | 2017-12-28 | Novozymes A/S | Use of enzymes, composition and method for removing soil |
WO2018002261A1 (en) | 2016-07-01 | 2018-01-04 | Novozymes A/S | Detergent compositions |
WO2018001959A1 (en) | 2016-06-30 | 2018-01-04 | Novozymes A/S | Lipase variants and compositions comprising surfactant and lipase variant |
WO2018007435A1 (en) | 2016-07-05 | 2018-01-11 | Novozymes A/S | Pectate lyase variants and polynucleotides encoding same |
WO2018007573A1 (en) | 2016-07-08 | 2018-01-11 | Novozymes A/S | Detergent compositions with galactanase |
WO2018011277A1 (en) | 2016-07-13 | 2018-01-18 | Novozymes A/S | Bacillus cibi dnase variants |
WO2018015295A1 (en) | 2016-07-18 | 2018-01-25 | Novozymes A/S | Lipase variants, polynucleotides encoding same and the use thereof |
EP3275988A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275987A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275989A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275985A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275986A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3284805A1 (en) | 2016-08-17 | 2018-02-21 | The Procter & Gamble Company | Cleaning composition comprising enzymes |
WO2018060216A1 (en) | 2016-09-29 | 2018-04-05 | Novozymes A/S | Use of enzyme for washing, method for washing and warewashing composition |
EP3309249A1 (en) | 2013-07-29 | 2018-04-18 | Novozymes A/S | Protease variants and polynucleotides encoding same |
WO2018077938A1 (en) | 2016-10-25 | 2018-05-03 | Novozymes A/S | Detergent compositions |
WO2018085310A1 (en) | 2016-11-01 | 2018-05-11 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care compositions |
WO2018084930A1 (en) | 2016-11-03 | 2018-05-11 | Milliken & Company | Leuco triphenylmethane colorants as bluing agents in laundry care compositions |
WO2018083093A1 (en) | 2016-11-01 | 2018-05-11 | Novozymes A/S | Multi-core granules |
WO2018085390A1 (en) | 2016-11-01 | 2018-05-11 | Milliken & Company | Leuco colorants as bluing agents in laundry care compositions |
WO2018085315A1 (en) | 2016-11-01 | 2018-05-11 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care compositions, packaging, kits and methods thereof |
EP3321360A2 (en) | 2013-01-03 | 2018-05-16 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
EP3330348A1 (en) | 2016-12-02 | 2018-06-06 | The Procter & Gamble Company | Cleaning compositions including enzymes |
WO2018102479A1 (en) | 2016-12-02 | 2018-06-07 | The Procter & Gamble Company | Cleaning compositions including enzymes |
WO2018108865A1 (en) | 2016-12-12 | 2018-06-21 | Novozymes A/S | Use of polypeptides |
WO2018108382A1 (en) | 2016-12-15 | 2018-06-21 | Unilever Plc | Laundry detergent composition |
EP3339423A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3357994A1 (en) | 2017-02-01 | 2018-08-08 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants |
WO2018178061A1 (en) | 2017-03-31 | 2018-10-04 | Novozymes A/S | Polypeptides having rnase activity |
WO2018177938A1 (en) | 2017-03-31 | 2018-10-04 | Novozymes A/S | Polypeptides having dnase activity |
WO2018177936A1 (en) | 2017-03-31 | 2018-10-04 | Novozymes A/S | Polypeptides having dnase activity |
EP3385362A1 (en) | 2017-04-05 | 2018-10-10 | Henkel AG & Co. KGaA | Detergent compositions comprising fungal mannanases |
EP3385361A1 (en) | 2017-04-05 | 2018-10-10 | Henkel AG & Co. KGaA | Detergent compositions comprising bacterial mannanases |
WO2018185280A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018185152A1 (en) | 2017-04-04 | 2018-10-11 | Novozymes A/S | Polypeptide compositions and uses thereof |
WO2018185269A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018185048A1 (en) | 2017-04-03 | 2018-10-11 | Novozymes A/S | Recovery process |
WO2018185150A1 (en) | 2017-04-04 | 2018-10-11 | Novozymes A/S | Polypeptides |
WO2018184818A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018184817A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018184816A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018185285A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018185181A1 (en) | 2017-04-04 | 2018-10-11 | Novozymes A/S | Glycosyl hydrolases |
WO2018184873A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Detergent compositions and uses thereof |
WO2018185267A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018202846A1 (en) | 2017-05-05 | 2018-11-08 | Novozymes A/S | Compositions comprising lipase and sulfite |
WO2018224544A1 (en) | 2017-06-08 | 2018-12-13 | Novozymes A/S | Compositions comprising polypeptides having cellulase activity and amylase activity, and uses thereof in cleaning and detergent compositions |
WO2019008036A1 (en) | 2017-07-07 | 2019-01-10 | Unilever Plc | Whitening composition |
WO2019008035A1 (en) | 2017-07-07 | 2019-01-10 | Unilever Plc | Laundry cleaning composition |
EP3453757A1 (en) | 2013-12-20 | 2019-03-13 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
WO2019057758A1 (en) | 2017-09-20 | 2019-03-28 | Novozymes A/S | Use of enzymes for improving water absorption and/or whiteness |
WO2019057902A1 (en) | 2017-09-22 | 2019-03-28 | Novozymes A/S | Novel polypeptides |
WO2019063499A1 (en) | 2017-09-27 | 2019-04-04 | Novozymes A/S | Lipase variants and microcapsule compositions comprising such lipase variants |
WO2019067390A1 (en) | 2017-09-27 | 2019-04-04 | The Procter & Gamble Company | Detergent compositions comprising lipases |
WO2019068713A1 (en) | 2017-10-02 | 2019-04-11 | Novozymes A/S | Polypeptides having mannanase activity and polynucleotides encoding same |
WO2019068715A1 (en) | 2017-10-02 | 2019-04-11 | Novozymes A/S | Polypeptides having mannanase activity and polynucleotides encoding same |
WO2019075228A1 (en) | 2017-10-12 | 2019-04-18 | Milliken & Company | Leuco colorants and compositions |
WO2019075144A1 (en) | 2017-10-12 | 2019-04-18 | The Procter & Gamble Company | Leuco colorants in combination with a second whitening agent as bluing agents in laundry care compositions |
WO2019075148A1 (en) | 2017-10-12 | 2019-04-18 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care compositions |
WO2019075146A1 (en) | 2017-10-12 | 2019-04-18 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care composition |
WO2019076800A1 (en) | 2017-10-16 | 2019-04-25 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2019076833A1 (en) | 2017-10-16 | 2019-04-25 | Novozymes A/S | Low dusting granules |
WO2019076834A1 (en) | 2017-10-16 | 2019-04-25 | Novozymes A/S | Low dusting granules |
WO2019084350A1 (en) | 2017-10-27 | 2019-05-02 | The Procter & Gamble Company | Detergent compositions comprising polypeptide variants |
WO2019081515A1 (en) | 2017-10-24 | 2019-05-02 | Novozymes A/S | Compositions comprising polypeptides having mannanase activity |
WO2019081721A1 (en) | 2017-10-27 | 2019-05-02 | Novozymes A/S | Dnase variants |
DE102017125560A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANSING COMPOSITIONS CONTAINING DISPERSINE III |
DE102017125559A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANSING COMPOSITIONS CONTAINING DISPERSINE II |
DE102017125558A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANING COMPOSITIONS CONTAINING DISPERSINE I |
WO2019086532A1 (en) | 2017-11-01 | 2019-05-09 | Novozymes A/S | Methods for cleaning medical devices |
WO2019089228A1 (en) | 2017-11-01 | 2019-05-09 | Milliken & Company | Leuco compounds, colorant compounds, and compositions containing the same |
WO2019086530A1 (en) | 2017-11-01 | 2019-05-09 | Novozymes A/S | Polypeptides and compositions comprising such polypeptides |
WO2019086528A1 (en) | 2017-11-01 | 2019-05-09 | Novozymes A/S | Polypeptides and compositions comprising such polypeptides |
WO2019105675A1 (en) | 2017-11-30 | 2019-06-06 | Unilever Plc | Detergent composition comprising protease |
WO2019110462A1 (en) | 2017-12-04 | 2019-06-13 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
EP3502244A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3502245A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3502246A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3502227A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2019147533A1 (en) | 2018-01-26 | 2019-08-01 | The Procter & Gamble Company | Water-soluble unit dose articles comprising enzyme |
EP3521434A1 (en) | 2014-03-12 | 2019-08-07 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2019154955A1 (en) | 2018-02-08 | 2019-08-15 | Novozymes A/S | Lipase variants and compositions thereof |
WO2019154951A1 (en) | 2018-02-08 | 2019-08-15 | Novozymes A/S | Lipases, lipase variants and compositions thereof |
US10400260B2 (en) | 2009-12-18 | 2019-09-03 | Novozymes, Inc. | Protease-deficient mutants of trichoderma for producing polypeptides |
WO2019168649A1 (en) | 2018-02-28 | 2019-09-06 | The Procter & Gamble Company | Cleaning compositions |
WO2019168650A1 (en) | 2018-02-28 | 2019-09-06 | The Procter & Gamble Company | Methods of cleaning |
WO2019201793A1 (en) | 2018-04-17 | 2019-10-24 | Novozymes A/S | Polypeptides comprising carbohydrate binding activity in detergent compositions and their use in reducing wrinkles in textile or fabric. |
WO2019201783A1 (en) | 2018-04-19 | 2019-10-24 | Novozymes A/S | Stabilized cellulase variants |
WO2019201785A1 (en) | 2018-04-19 | 2019-10-24 | Novozymes A/S | Stabilized cellulase variants |
WO2019219531A1 (en) | 2018-05-17 | 2019-11-21 | Unilever Plc | Cleaning composition |
WO2019245839A1 (en) | 2018-06-19 | 2019-12-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2019245838A1 (en) | 2018-06-19 | 2019-12-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2020002604A1 (en) | 2018-06-28 | 2020-01-02 | Novozymes A/S | Detergent compositions and uses thereof |
WO2020002608A1 (en) | 2018-06-29 | 2020-01-02 | Novozymes A/S | Detergent compositions and uses thereof |
WO2020007875A1 (en) | 2018-07-03 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020008024A1 (en) | 2018-07-06 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020007863A1 (en) | 2018-07-02 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020008043A1 (en) | 2018-07-06 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020023188A1 (en) | 2018-07-27 | 2020-01-30 | The Procter & Gamble Company | Water-soluble unit dose articles comprising water-soluble fibrous structures and protease |
EP3608403A2 (en) | 2014-12-15 | 2020-02-12 | Henkel AG & Co. KGaA | Detergent composition comprising subtilase variants |
US10563189B2 (en) | 2008-06-06 | 2020-02-18 | The Procter & Gamble Company | Compositions and methods comprising variant microbial proteases |
EP3611260A1 (en) | 2013-07-29 | 2020-02-19 | Novozymes A/S | Protease variants and polynucleotides encoding same |
WO2020058024A1 (en) | 2018-09-17 | 2020-03-26 | Unilever Plc | Detergent composition |
WO2020070011A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition |
WO2020070063A2 (en) | 2018-10-01 | 2020-04-09 | Novozymes A/S | Detergent compositions and uses thereof |
WO2020070014A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition comprising anionic surfactant and a polypeptide having rnase activity |
WO2020070199A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Polypeptides having alpha-mannan degrading activity and polynucleotides encoding same |
WO2020070249A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Cleaning compositions |
WO2020070209A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition |
WO2020074545A1 (en) | 2018-10-11 | 2020-04-16 | Novozymes A/S | Cleaning compositions and uses thereof |
EP3647397A1 (en) | 2018-10-31 | 2020-05-06 | Henkel AG & Co. KGaA | Cleaning compositions containing dispersins iv |
EP3647398A1 (en) | 2018-10-31 | 2020-05-06 | Henkel AG & Co. KGaA | Cleaning compositions containing dispersins v |
WO2020104158A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104157A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104155A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104156A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104159A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020114965A1 (en) | 2018-12-03 | 2020-06-11 | Novozymes A/S | LOW pH POWDER DETERGENT COMPOSITION |
WO2020127775A1 (en) | 2018-12-21 | 2020-06-25 | Novozymes A/S | Detergent pouch comprising metalloproteases |
WO2020127796A2 (en) | 2018-12-21 | 2020-06-25 | Novozymes A/S | Polypeptides having peptidoglycan degrading activity and polynucleotides encoding same |
WO2020186030A1 (en) | 2019-03-14 | 2020-09-17 | The Procter & Gamble Company | Cleaning compositions comprising enzymes |
WO2020186052A1 (en) | 2019-03-14 | 2020-09-17 | The Procter & Gamble Company | Method for treating cotton |
WO2020186028A1 (en) | 2019-03-14 | 2020-09-17 | The Procter & Gamble Company | Cleaning compositions comprising enzymes |
WO2020188095A1 (en) | 2019-03-21 | 2020-09-24 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
EP3715442A1 (en) | 2016-03-23 | 2020-09-30 | Novozymes A/S | Use of polypeptide having dnase activity for treating fabrics |
WO2020201403A1 (en) | 2019-04-03 | 2020-10-08 | Novozymes A/S | Polypeptides having beta-glucanase activity, polynucleotides encoding same and uses thereof in cleaning and detergent compositions |
EP3722406A1 (en) | 2014-04-11 | 2020-10-14 | Novozymes A/S | Detergent composition |
WO2020207944A1 (en) | 2019-04-10 | 2020-10-15 | Novozymes A/S | Polypeptide variants |
WO2020208056A1 (en) | 2019-04-12 | 2020-10-15 | Novozymes A/S | Stabilized glycoside hydrolase variants |
EP3739029A1 (en) | 2014-07-04 | 2020-11-18 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
WO2020229535A1 (en) | 2019-05-16 | 2020-11-19 | Unilever Plc | Laundry composition |
EP3741849A2 (en) | 2014-12-19 | 2020-11-25 | Novozymes A/S | Protease variants and polynucleotides encoding same |
EP3741848A2 (en) | 2014-12-19 | 2020-11-25 | Novozymes A/S | Protease variants and polynucleotides encoding same |
EP3741283A1 (en) | 2019-05-22 | 2020-11-25 | The Procter & Gamble Company | Automatic dishwashing method |
WO2020243738A1 (en) | 2019-05-24 | 2020-12-03 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2020259948A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020260038A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020260040A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020259949A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020260006A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent compositions |
WO2020264552A1 (en) | 2019-06-24 | 2020-12-30 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants |
WO2020259947A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2021001400A1 (en) | 2019-07-02 | 2021-01-07 | Novozymes A/S | Lipase variants and compositions thereof |
WO2021009067A1 (en) | 2019-07-12 | 2021-01-21 | Novozymes A/S | Enzymatic emulsions for detergents |
EP3786269A1 (en) | 2013-06-06 | 2021-03-03 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
WO2021037895A1 (en) | 2019-08-27 | 2021-03-04 | Novozymes A/S | Detergent composition |
WO2021037878A1 (en) | 2019-08-27 | 2021-03-04 | Novozymes A/S | Composition comprising a lipase |
WO2021043764A1 (en) | 2019-09-02 | 2021-03-11 | Unilever Global Ip Limited | Detergent composition |
WO2021053127A1 (en) | 2019-09-19 | 2021-03-25 | Novozymes A/S | Detergent composition |
WO2021053122A1 (en) | 2019-09-19 | 2021-03-25 | Unilever Ip Holdings B.V. | Detergent compositions |
WO2021064068A1 (en) | 2019-10-03 | 2021-04-08 | Novozymes A/S | Polypeptides comprising at least two carbohydrate binding domains |
WO2021069516A1 (en) | 2019-10-07 | 2021-04-15 | Unilever Ip Holdings B.V. | Detergent composition |
WO2021081547A2 (en) | 2019-10-24 | 2021-04-29 | The Procter & Gamble Company | Automatic dishwashing detergent composition comprising a protease |
WO2021081548A1 (en) | 2019-10-24 | 2021-04-29 | The Procter & Gamble Company | Automatic dishwashing detergent composition comprising an amylase |
EP3835396A1 (en) | 2019-12-09 | 2021-06-16 | The Procter & Gamble Company | A detergent composition comprising a polymer |
WO2021123307A2 (en) | 2019-12-20 | 2021-06-24 | Novozymes A/S | Polypeptides having proteolytic activity and use thereof |
WO2021122118A1 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning compositions comprising dispersins vi |
WO2021122117A1 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning composition coprising a dispersin and a carbohydrase |
WO2021122121A1 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning compositions comprising dispersins ix |
WO2021121394A1 (en) | 2019-12-20 | 2021-06-24 | Novozymes A/S | Stabilized liquid boron-free enzyme compositions |
WO2021152123A1 (en) | 2020-01-31 | 2021-08-05 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
WO2021152120A1 (en) | 2020-01-31 | 2021-08-05 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
WO2021151536A1 (en) | 2020-01-29 | 2021-08-05 | Unilever Ip Holdings B.V. | Laundry detergent product |
EP3862412A1 (en) | 2020-02-04 | 2021-08-11 | The Procter & Gamble Company | Detergent composition |
EP3878957A1 (en) | 2014-05-27 | 2021-09-15 | Novozymes A/S | Methods for producing lipases |
EP3878960A1 (en) | 2014-07-04 | 2021-09-15 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
EP3892708A1 (en) | 2020-04-06 | 2021-10-13 | Henkel AG & Co. KGaA | Cleaning compositions comprising dispersin variants |
WO2021204838A1 (en) | 2020-04-08 | 2021-10-14 | Novozymes A/S | Carbohydrate binding module variants |
WO2021214059A1 (en) | 2020-04-21 | 2021-10-28 | Novozymes A/S | Cleaning compositions comprising polypeptides having fructan degrading activity |
WO2021247801A1 (en) | 2020-06-05 | 2021-12-09 | The Procter & Gamble Company | Detergent compositions containing a branched surfactant |
WO2021249927A1 (en) | 2020-06-08 | 2021-12-16 | Unilever Ip Holdings B.V. | Method of improving protease activity |
EP3929285A2 (en) | 2015-07-01 | 2021-12-29 | Novozymes A/S | Methods of reducing odor |
WO2021259099A1 (en) | 2020-06-24 | 2021-12-30 | Novozymes A/S | Use of cellulases for removing dust mite from textile |
EP3936593A1 (en) | 2020-07-08 | 2022-01-12 | Henkel AG & Co. KGaA | Cleaning compositions and uses thereof |
WO2022023250A1 (en) | 2020-07-27 | 2022-02-03 | Unilever Ip Holdings B.V. | Use of an enzyme and surfactant for inhibiting microorganisms |
EP3949824A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method |
EP3950911A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method |
EP3950912A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method |
EP3950939A2 (en) | 2015-07-06 | 2022-02-09 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
EP3950913A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method and pack |
EP3957711A2 (en) | 2015-10-28 | 2022-02-23 | Novozymes A/S | Detergent composition comprising amylase and protease variants |
WO2022043321A2 (en) | 2020-08-25 | 2022-03-03 | Novozymes A/S | Variants of a family 44 xyloglucanase |
WO2022043042A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Detergent composition |
WO2022043138A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Surfactant and detergent composition |
WO2022042989A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Surfactant and detergent composition |
WO2022043045A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Detergent composition |
WO2022042977A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Detergent composition |
WO2022058322A1 (en) | 2020-09-15 | 2022-03-24 | Novozymes A/S | Animal feed comprising insects or insect meal |
WO2022074037A2 (en) | 2020-10-07 | 2022-04-14 | Novozymes A/S | Alpha-amylase variants |
WO2022084303A2 (en) | 2020-10-20 | 2022-04-28 | Novozymes A/S | Use of polypeptides having dnase activity |
WO2022094163A1 (en) | 2020-10-29 | 2022-05-05 | The Procter & Gamble Company | Cleaning composition comprising alginate lyase enzymes |
WO2022090361A2 (en) | 2020-10-29 | 2022-05-05 | Novozymes A/S | Lipase variants and compositions comprising such lipase variants |
WO2022093189A1 (en) | 2020-10-27 | 2022-05-05 | Milliken & Company | Compositions comprising leuco compounds and colorants |
WO2022090320A1 (en) | 2020-10-28 | 2022-05-05 | Novozymes A/S | Use of lipoxygenase |
WO2022103725A1 (en) | 2020-11-13 | 2022-05-19 | Novozymes A/S | Detergent composition comprising a lipase |
EP4001390A1 (en) | 2020-11-17 | 2022-05-25 | The Procter & Gamble Company | Automatic dishwashing method with alkaline rinse |
EP4001387A1 (en) | 2020-11-17 | 2022-05-25 | The Procter & Gamble Company | Automatic dishwashing composition commprising amphiphilic graft polymer |
EP4001388A1 (en) | 2020-11-17 | 2022-05-25 | The Procter & Gamble Company | Automatic dishwashing method with amphiphilic graft polymer in the rinse |
WO2022106400A1 (en) | 2020-11-18 | 2022-05-27 | Novozymes A/S | Combination of immunochemically different proteases |
EP4006131A1 (en) | 2020-11-30 | 2022-06-01 | The Procter & Gamble Company | Method of laundering fabric |
WO2022122480A1 (en) | 2020-12-07 | 2022-06-16 | Unilever Ip Holdings B.V. | Detergent compositions |
WO2022122481A1 (en) | 2020-12-07 | 2022-06-16 | Unilever Ip Holdings B.V. | Detergent compositions |
WO2022136389A1 (en) | 2020-12-23 | 2022-06-30 | Basf Se | Amphiphilic alkoxylated polyamines and their uses |
EP4032966A1 (en) | 2021-01-22 | 2022-07-27 | Novozymes A/S | Liquid enzyme composition with sulfite scavenger |
WO2022162043A1 (en) | 2021-01-28 | 2022-08-04 | Novozymes A/S | Lipase with low malodor generation |
WO2022171872A1 (en) | 2021-02-12 | 2022-08-18 | Novozymes A/S | Stabilized biological detergents |
WO2022171780A2 (en) | 2021-02-12 | 2022-08-18 | Novozymes A/S | Alpha-amylase variants |
US11441140B2 (en) | 2015-12-07 | 2022-09-13 | Henkel Ag & Co. Kgaa | Dishwashing compositions comprising polypeptides having beta-glucanase activity and uses thereof |
WO2022189521A1 (en) | 2021-03-12 | 2022-09-15 | Novozymes A/S | Polypeptide variants |
EP4060010A2 (en) | 2021-03-15 | 2022-09-21 | The Procter & Gamble Company | Cleaning compositions containing polypeptide variants |
EP4060036A1 (en) | 2021-03-15 | 2022-09-21 | Novozymes A/S | Polypeptide variants |
WO2022194673A1 (en) | 2021-03-15 | 2022-09-22 | Novozymes A/S | Dnase variants |
WO2022199418A1 (en) | 2021-03-26 | 2022-09-29 | Novozymes A/S | Detergent composition with reduced polymer content |
EP4086330A1 (en) | 2021-05-06 | 2022-11-09 | The Procter & Gamble Company | Surface treatment |
WO2022235720A1 (en) | 2021-05-05 | 2022-11-10 | The Procter & Gamble Company | Methods for making cleaning compositions and detecting soils |
EP4108767A1 (en) | 2021-06-22 | 2022-12-28 | The Procter & Gamble Company | Cleaning or treatment compositions containing nuclease enzymes |
WO2022268885A1 (en) | 2021-06-23 | 2022-12-29 | Novozymes A/S | Alpha-amylase polypeptides |
EP4123006A1 (en) | 2021-07-19 | 2023-01-25 | The Procter & Gamble Company | Composition comprising spores and pro-perfume materials |
EP4123007A1 (en) | 2021-07-19 | 2023-01-25 | The Procter & Gamble Company | Fabric treatment using bacterial spores |
WO2023017794A1 (en) | 2021-08-10 | 2023-02-16 | 株式会社日本触媒 | Polyalkylene-oxide-containing compound |
WO2023041694A1 (en) | 2021-09-20 | 2023-03-23 | Unilever Ip Holdings B.V. | Detergent composition |
WO2023064749A1 (en) | 2021-10-14 | 2023-04-20 | The Procter & Gamble Company | A fabric and home care product comprising cationic soil release polymer and lipase enzyme |
EP4194537A1 (en) | 2021-12-08 | 2023-06-14 | The Procter & Gamble Company | Laundry treatment cartridge |
EP4194536A1 (en) | 2021-12-08 | 2023-06-14 | The Procter & Gamble Company | Laundry treatment cartridge |
WO2023114792A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Home care composition comprising an amylase |
WO2023114795A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Automatic dishwashing composition comprising a protease |
WO2023114794A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Fabric and home care composition comprising a protease |
WO2023114793A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Home care composition |
WO2023116569A1 (en) | 2021-12-21 | 2023-06-29 | Novozymes A/S | Composition comprising a lipase and a booster |
EP4206309A1 (en) | 2021-12-30 | 2023-07-05 | Novozymes A/S | Protein particles with improved whiteness |
EP4234664A1 (en) | 2022-02-24 | 2023-08-30 | Evonik Operations GmbH | Composition comprising glucolipids and enzymes |
WO2023165950A1 (en) | 2022-03-04 | 2023-09-07 | Novozymes A/S | Dnase variants and compositions |
WO2023165507A1 (en) | 2022-03-02 | 2023-09-07 | Novozymes A/S | Use of xyloglucanase for improvement of sustainability of detergents |
WO2023194204A1 (en) | 2022-04-08 | 2023-10-12 | Novozymes A/S | Hexosaminidase variants and compositions |
EP4273209A1 (en) | 2022-05-04 | 2023-11-08 | The Procter & Gamble Company | Machine-cleaning compositions containing enzymes |
EP4273210A1 (en) | 2022-05-04 | 2023-11-08 | The Procter & Gamble Company | Detergent compositions containing enzymes |
EP4279571A1 (en) | 2022-05-19 | 2023-11-22 | The Procter & Gamble Company | Laundry composition comprising spores |
WO2023227335A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Liquid composition comprising linear alkyl benzene sulphonate, methyl ester ethoxylate and alkoxylated zwitterionic polyamine polymer |
WO2023227331A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Composition comprising a specific methyl ester ethoxylate surfactant and a lipase |
WO2023227375A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Laundry liquid composition comprising a surfactant, an aminocarboxylate, an organic acid and a fragrance |
WO2023227421A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Laundry liquid composition comprising a surfactant, an alkoxylated zwitterionic polyamine polymer, and a fragrance |
WO2023227332A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Laundry liquid composition comprising a surfactant, an alkoxylated zwitterionic polyamine polymer and a protease |
WO2023233028A1 (en) | 2022-06-03 | 2023-12-07 | Unilever Ip Holdings B.V. | Laundry detergent product |
US11840718B2 (en) | 2010-12-22 | 2023-12-12 | Novozymes A/S | Processes for producing ethanol |
WO2023247664A2 (en) | 2022-06-24 | 2023-12-28 | Novozymes A/S | Lipase variants and compositions comprising such lipase variants |
WO2023247348A1 (en) | 2022-06-21 | 2023-12-28 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
EP4321604A1 (en) | 2022-08-08 | 2024-02-14 | The Procter & Gamble Company | A fabric and home care composition comprising surfactant and a polyester |
WO2024056332A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
WO2024056278A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
WO2024056333A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
WO2024056334A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
US11939552B2 (en) | 2013-06-24 | 2024-03-26 | Novozymes A/S | Process of recovering oil |
EP4349946A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Unit dose fabric treatment product |
EP4349942A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349943A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349947A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349944A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349948A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349945A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
US11965143B2 (en) | 2013-06-24 | 2024-04-23 | Novozymes A/S | Process of recovering oil |
EP4361239A1 (en) | 2022-10-25 | 2024-05-01 | Unilever IP Holdings B.V. | Laundry liquid composition |
WO2024088716A1 (en) | 2022-10-25 | 2024-05-02 | Unilever Ip Holdings B.V. | Composition |
WO2024088706A1 (en) | 2022-10-25 | 2024-05-02 | Unilever Ip Holdings B.V. | Composition |
WO2024094800A1 (en) | 2022-11-04 | 2024-05-10 | The Procter & Gamble Company | Fabric and home care composition |
WO2024094802A1 (en) | 2022-11-04 | 2024-05-10 | The Procter & Gamble Company | Fabric and home care composition |
WO2024094803A1 (en) | 2022-11-04 | 2024-05-10 | The Procter & Gamble Company | Fabric and home care composition |
WO2024115106A1 (en) | 2022-11-29 | 2024-06-06 | Unilever Ip Holdings B.V. | Composition |
WO2024121058A1 (en) | 2022-12-05 | 2024-06-13 | Novozymes A/S | A composition comprising a lipase and a peptide |
WO2024119298A1 (en) | 2022-12-05 | 2024-06-13 | The Procter & Gamble Company | Fabric and home care composition comprising a polyalkylenecarbonate compound |
EP4386074A1 (en) | 2022-12-16 | 2024-06-19 | The Procter & Gamble Company | Fabric and home care composition |
WO2024126483A1 (en) | 2022-12-14 | 2024-06-20 | Novozymes A/S | Improved lipase (gcl1) variants |
WO2024129520A1 (en) | 2022-12-12 | 2024-06-20 | The Procter & Gamble Company | Fabric and home care composition |
EP4388967A1 (en) | 2022-12-19 | 2024-06-26 | The Procter & Gamble Company | Dishwashing method |
EP4389864A1 (en) | 2022-12-20 | 2024-06-26 | Basf Se | Cutinases |
WO2024133344A1 (en) | 2022-12-20 | 2024-06-27 | Novozymes A/S | A method for providing a candidate biological sequence and related electronic device |
WO2024131880A2 (en) | 2022-12-23 | 2024-06-27 | Novozymes A/S | Detergent composition comprising catalase and amylase |
WO2024156628A1 (en) | 2023-01-23 | 2024-08-02 | Novozymes A/S | Cleaning compositions and uses thereof |
EP4410941A1 (en) | 2023-02-01 | 2024-08-07 | The Procter & Gamble Company | Detergent compositions containing enzymes |
WO2024194245A1 (en) | 2023-03-21 | 2024-09-26 | Novozymes A/S | Detergent compositions based on biosurfactants |
WO2024194190A1 (en) | 2023-03-17 | 2024-09-26 | Unilever Ip Holdings B.V. | Composition |
WO2024194098A1 (en) | 2023-03-21 | 2024-09-26 | Unilever Ip Holdings B.V. | Detergent unit dose |
WO2024213438A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213430A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213443A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213376A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213428A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213513A1 (en) | 2023-04-12 | 2024-10-17 | Novozymes A/S | Compositions comprising polypeptides having alkaline phosphatase activity |
WO2024223218A1 (en) | 2023-04-25 | 2024-10-31 | Unilever Ip Holdings B.V. | Composition |
WO2024226828A2 (en) | 2023-04-26 | 2024-10-31 | Novozymes A/S | Cleaning composition and cleaning method |
EP4458932A1 (en) | 2023-05-04 | 2024-11-06 | The Procter & Gamble Company | A fabric and home care composition |
EP4458933A1 (en) | 2023-05-05 | 2024-11-06 | The Procter & Gamble Company | A fabric and home care composition comprising a propoxylated polyol |
EP4461795A1 (en) | 2023-05-10 | 2024-11-13 | Novozymes A/S | Detergent composition comprising laccase |
EP4461796A1 (en) | 2023-05-10 | 2024-11-13 | Novozymes A/S | Detergent composition comprising laccase |
WO2024231483A1 (en) | 2023-05-11 | 2024-11-14 | Novozymes A/S | Automatic dishwashing detergent compositions comprising a lipase |
EP4481027A1 (en) | 2023-06-19 | 2024-12-25 | The Procter & Gamble Company | Cleaning compositions containing enzymes |
EP4484536A1 (en) | 2023-06-26 | 2025-01-01 | The Procter & Gamble Company | Fabric and home care composition |
WO2025002934A1 (en) | 2023-06-28 | 2025-01-02 | Novozymes A/S | Detergent composition comprising lipases |
EP4488351A1 (en) | 2023-07-03 | 2025-01-08 | The Procter & Gamble Company | Compositions containing a porphyrin binding protein |
WO2025011808A1 (en) | 2023-07-11 | 2025-01-16 | Unilever Ip Holdings B.V. | Method for treating fabric |
WO2025011886A1 (en) | 2023-07-11 | 2025-01-16 | Unilever Ip Holdings B.V. | Method for treating fabric |
WO2025011933A1 (en) | 2023-07-07 | 2025-01-16 | Novozymes A/S | Washing method for removing proteinaceous stains |
WO2025012293A1 (en) | 2023-07-13 | 2025-01-16 | Unilever Ip Holdings B.V. | Washing machine and method |
WO2025016669A1 (en) | 2023-07-19 | 2025-01-23 | Unilever Ip Holdings B.V. | Laundry capsule |
WO2025026734A1 (en) | 2023-08-02 | 2025-02-06 | Unilever Ip Holdings B.V. | Composition |
US12227785B2 (en) | 2023-10-23 | 2025-02-18 | Novozymes A/S | Compositions comprising a low pH alpha-amylase and a thermostable protease for liquefaction |
EP4509589A1 (en) | 2023-08-16 | 2025-02-19 | Unilever IP Holdings B.V. | Unit dose product |
Families Citing this family (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2076591A2 (en) | 2006-10-20 | 2009-07-08 | Danisco US, INC., Genencor Division | Polyol oxidases |
RU2526516C2 (en) | 2008-02-04 | 2014-08-20 | ДАНИСКО ЮЭс ИНК. | Ts23 alpha-amylase versions with altered properties |
CA2759695C (en) * | 2009-04-24 | 2018-05-01 | Danisco Us Inc. | Proteases with modified pro regions |
MX350391B (en) * | 2011-09-22 | 2017-09-06 | Novozymes As | Polypeptides having protease activity and polynucleotides encoding same. |
US10619145B2 (en) | 2014-11-04 | 2020-04-14 | Novozymes A/S | Polypeptides having serine protease activity and polynucleotides encoding same and their application in animal feed |
EP3101102B2 (en) | 2015-06-05 | 2023-12-13 | The Procter & Gamble Company | Compacted liquid laundry detergent composition |
HUE036591T2 (en) | 2015-06-05 | 2018-08-28 | Procter & Gamble | Compacted liquid laundry detergent composition |
EP3101107B1 (en) | 2015-06-05 | 2019-04-24 | The Procter and Gamble Company | Compacted liquid laundry detergent composition |
US10358625B2 (en) * | 2015-07-17 | 2019-07-23 | S. C. Johnson & Son, Inc. | Non-corrosive cleaning composition |
WO2017112540A1 (en) | 2015-12-22 | 2017-06-29 | Novozymes A/S | Processes for producing fermentation products |
US10550443B2 (en) | 2016-12-02 | 2020-02-04 | The Procter & Gamble Company | Cleaning compositions including enzymes |
RU2019132448A (en) * | 2017-03-15 | 2021-04-15 | ДюПон НЬЮТРИШН БАЙОСАЙЕНСИЗ АпС | METHODS OF APPLICATION OF ARCHEY SERINE PROTEASE |
KR102316445B1 (en) * | 2019-11-29 | 2021-10-26 | 씨제이제일제당 주식회사 | A novel serine protease variant |
CN111172140B (en) * | 2020-01-21 | 2022-04-19 | 浙江工业大学 | A kind of nitrilase mutant and its application in the preparation of antiepileptic drug intermediates |
CN111329830B (en) * | 2020-03-06 | 2022-08-30 | 重庆雅素生物科技有限公司 | Method for obtaining micrococcus bacterial fermentation cytolysis liquid and application of micrococcus bacterial fermentation cytolysis liquid in anti-aging |
CN114107266B (en) * | 2021-11-29 | 2023-11-14 | 青岛尚德生物技术有限公司 | Protease mutant with improved heat resistance, encoding gene and application thereof |
US20240018331A1 (en) * | 2022-07-15 | 2024-01-18 | Battelle Memorial Institute | Polyamide recovery for enzymatic depolymerization |
CN116941532B (en) * | 2023-08-29 | 2024-04-16 | 安徽江淮园艺种业股份有限公司 | Method for promoting regeneration of protoplast by using low-temperature plasma |
Citations (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB1372034A (en) | 1970-12-31 | 1974-10-30 | Unilever Ltd | Detergent compositions |
EP0214761A2 (en) | 1985-08-07 | 1987-03-18 | Novo Nordisk A/S | An enzymatic detergent additive, a detergent, and a washing method |
EP0218272A1 (en) | 1985-08-09 | 1987-04-15 | Gist-Brocades N.V. | Novel lipolytic enzymes and their use in detergent compositions |
EP0238023A2 (en) | 1986-03-17 | 1987-09-23 | Novo Nordisk A/S | Process for the production of protein products in Aspergillus oryzae and a promoter for use in Aspergillus |
EP0258068A2 (en) | 1986-08-29 | 1988-03-02 | Novo Nordisk A/S | Enzymatic detergent additive |
EP0305216A1 (en) | 1987-08-28 | 1989-03-01 | Novo Nordisk A/S | Recombinant Humicola lipase and process for the production of recombinant humicola lipases |
EP0331376A2 (en) | 1988-02-28 | 1989-09-06 | Amano Pharmaceutical Co., Ltd. | Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it |
WO1996034946A1 (en) | 1995-05-05 | 1996-11-07 | Novo Nordisk A/S | Protease variants and compositions |
WO1999034011A2 (en) | 1997-12-24 | 1999-07-08 | Genencor International, Inc. | Method of assaying for a preferred enzyme and/or detergent |
WO2002014490A2 (en) | 2000-08-11 | 2002-02-21 | Genencor International, Inc. | Bacillus transformation, transformants and mutant libraries |
US6376450B1 (en) | 1998-10-23 | 2002-04-23 | Chanchal Kumar Ghosh | Cleaning compositions containing multiply-substituted protease variants |
WO2002050245A2 (en) | 2000-12-18 | 2002-06-27 | Genencor International, Inc. | Novel cellulase producing actinomycetes, cellulase produced therefrom and method of producing same |
Family Cites Families (86)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3840433A (en) | 1968-09-23 | 1974-10-08 | Novo Terapeutisk Labor As | Dehairing of leather |
GB1296839A (en) | 1969-05-29 | 1972-11-22 | ||
ES421535A1 (en) | 1973-01-13 | 1976-06-16 | Roehm Gmbh | Method for preparing tannable pelts from animal skins and hides |
DK187280A (en) | 1980-04-30 | 1981-10-31 | Novo Industri As | RUIT REDUCING AGENT FOR A COMPLETE LAUNDRY |
GR76237B (en) | 1981-08-08 | 1984-08-04 | Procter & Gamble | |
JPS58144105A (en) | 1982-02-12 | 1983-08-27 | Kurabo Ind Ltd | Production of descaled animal fiber |
US4760025A (en) | 1984-05-29 | 1988-07-26 | Genencor, Inc. | Modified enzymes and methods for making same |
US5264366A (en) | 1984-05-29 | 1993-11-23 | Genencor, Inc. | Protease deficient bacillus |
US5763257A (en) | 1984-05-29 | 1998-06-09 | Genencor International, Inc. | Modified subtilisins having amino acid alterations |
US5972682A (en) | 1984-05-29 | 1999-10-26 | Genencor International, Inc. | Enzymatically active modified subtilisins |
US4965188A (en) | 1986-08-22 | 1990-10-23 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme |
US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
US5364770A (en) | 1985-08-29 | 1994-11-15 | Genencor International Inc. | Heterologous polypeptides expressed in aspergillus |
US5766912A (en) | 1986-03-17 | 1998-06-16 | Novo Nordisk A/S | Humicola lipase produced in aspergillus |
US5322770A (en) | 1989-12-22 | 1994-06-21 | Hoffman-Laroche Inc. | Reverse transcription with thermostable DNA polymerases - high temperature reverse transcription |
WO1988006624A2 (en) * | 1987-02-27 | 1988-09-07 | Gist-Brocades N.V. | Molecular cloning and expression of genes encoding proteolytic enzymes |
HUT50877A (en) | 1987-02-27 | 1990-03-28 | Gist Brocades Nv | Process for producing stable gene amplification in chromosomal dna of procaryote microorganisms |
WO1988009367A1 (en) | 1987-05-29 | 1988-12-01 | Genencor, Inc. | Cutinase cleaning composition |
US5314692A (en) | 1987-08-24 | 1994-05-24 | Cultor Ltd. | Enzyme premix for feed and method |
JP2664259B2 (en) | 1987-10-30 | 1997-10-15 | エルエスアイ ロジック コーポレーション | Semiconductor device package and method of manufacturing the same |
ATE129523T1 (en) | 1988-01-07 | 1995-11-15 | Novo Nordisk As | SPECIFIC PROTEASES. |
US5324653A (en) | 1988-02-11 | 1994-06-28 | Gist-Brocades N.V. | Recombinant genetic means for the production of serine protease muteins |
US4977252A (en) | 1988-03-11 | 1990-12-11 | National Starch And Chemical Investment Holding Corporation | Modified starch emulsifier characterized by shelf stability |
CA1333777C (en) | 1988-07-01 | 1995-01-03 | Randy M. Berka | Aspartic proteinase deficient filamentous fungi |
DE3841152A1 (en) | 1988-12-07 | 1990-06-13 | Hoechst Ag | USE OF BACTERIA-LYING ENZYME PRODUCT AS AN ADDITIVE TO IMPROVE THE FEED RECYCLING IN ANIMAL PRODUCTION |
WO1990009446A1 (en) | 1989-02-17 | 1990-08-23 | Plant Genetic Systems N.V. | Cutinase |
DK158989D0 (en) | 1989-03-31 | 1989-03-31 | Novo Industri As | PROCEDURE FOR ENZYMATIC CARE OF SKIN OR SKIN |
DE3922748B4 (en) | 1989-07-11 | 2006-01-05 | Röhm GmbH & Co. KG | Enzymatic soft process |
WO1991016422A1 (en) | 1990-04-14 | 1991-10-31 | Kali-Chemie Aktiengesellschaft | Alkaline bacillus lipases, coding dna sequences therefor and bacilli which produce these lipases |
US5354559A (en) | 1990-05-29 | 1994-10-11 | Grain Processing Corporation | Encapsulation with starch hydrolyzate acid esters |
US5401657A (en) | 1990-08-06 | 1995-03-28 | Gist-Brocades, N.V. | Gram-positive alkaliphilic microorganisms |
EP0548228B1 (en) | 1990-09-13 | 1998-08-12 | Novo Nordisk A/S | Lipase variants |
DE4035839A1 (en) | 1990-11-10 | 1992-05-14 | Roehm Gmbh | PROTEASE AS A ACTIVE ENZYME, TENSIDE-FREE, FIXED ENZYMERS |
EP0495257B1 (en) | 1991-01-16 | 2002-06-12 | The Procter & Gamble Company | Compact detergent compositions with high activity cellulase |
CZ285164B6 (en) | 1991-03-26 | 1999-05-12 | Röhm Gmbh | Process for producing pelts ready for tanning |
JP2905311B2 (en) | 1991-04-24 | 1999-06-14 | ユニチカ株式会社 | Shrinkproof processing method of animal hair fiber products |
US5340735A (en) | 1991-05-29 | 1994-08-23 | Cognis, Inc. | Bacillus lentus alkaline protease variants with increased stability |
US5646028A (en) | 1991-06-18 | 1997-07-08 | The Clorox Company | Alkaline serine protease streptomyces griseus var. alkaliphus having enhanced stability against urea or guanidine |
KR100303620B1 (en) | 1992-12-01 | 2001-11-22 | 피아 스타르 | Enrichment of enzyme reaction |
AU6029894A (en) | 1993-01-18 | 1994-08-15 | Procter & Gamble Company, The | Machine dishwashing detergent compositions |
DK48693D0 (en) | 1993-04-30 | 1993-04-30 | Novo Nordisk As | ENZYME |
DK77393D0 (en) | 1993-06-29 | 1993-06-29 | Novo Nordisk As | ENZYMER ACTIVATION |
US5698504A (en) | 1993-07-01 | 1997-12-16 | The Procter & Gamble Company | Machine dishwashing composition containing oxygen bleach and paraffin oil and benzotriazole compound silver tarnishing inhibitors |
US5486303A (en) | 1993-08-27 | 1996-01-23 | The Procter & Gamble Company | Process for making high density detergent agglomerates using an anhydrous powder additive |
DE4342680A1 (en) | 1993-12-15 | 1995-06-22 | Pfeiffer Erich Gmbh & Co Kg | Discharge device for media |
US5861271A (en) | 1993-12-17 | 1999-01-19 | Fowler; Timothy | Cellulase enzymes and systems for their expressions |
US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
US5691295A (en) | 1995-01-17 | 1997-11-25 | Cognis Gesellschaft Fuer Biotechnologie Mbh | Detergent compositions |
ES2364774T3 (en) | 1994-02-24 | 2011-09-14 | HENKEL AG & CO. KGAA | IMPROVED AND DETERGENT ENZYMES THAT CONTAIN THEM. |
ATE512226T1 (en) | 1994-02-24 | 2011-06-15 | Henkel Ag & Co Kgaa | IMPROVED ENZYMES AND DETERGENTS WITH IT |
US5686014A (en) | 1994-04-07 | 1997-11-11 | The Procter & Gamble Company | Bleach compositions comprising manganese-containing bleach catalysts |
JPH11500465A (en) | 1994-06-17 | 1999-01-12 | ジェネンコア インターナショナル インコーポレーテッド | Cleaning composition having plant cell wall degrading enzyme and its use in cleaning method |
GB2294268A (en) | 1994-07-07 | 1996-04-24 | Procter & Gamble | Bleaching composition for dishwasher use |
GB9416841D0 (en) | 1994-08-19 | 1994-10-12 | Finnfeeds Int Ltd | An enzyme feed additive and animal feed including it |
US5879584A (en) | 1994-09-10 | 1999-03-09 | The Procter & Gamble Company | Process for manufacturing aqueous compositions comprising peracids |
US5691297A (en) | 1994-09-20 | 1997-11-25 | The Procter & Gamble Company | Process for making a high density detergent composition by controlling agglomeration within a dispersion index |
US5516448A (en) | 1994-09-20 | 1996-05-14 | The Procter & Gamble Company | Process for making a high density detergent composition which includes selected recycle streams for improved agglomerate |
US5489392A (en) | 1994-09-20 | 1996-02-06 | The Procter & Gamble Company | Process for making a high density detergent composition in a single mixer/densifier with selected recycle streams for improved agglomerate properties |
US5660982A (en) | 1994-10-04 | 1997-08-26 | Tryggvason; Karl | Laminin chains: diagnostic uses |
DK0784706T3 (en) | 1994-10-07 | 2000-04-25 | Novo Nordisk As | Process for processing hides or skins for leather |
DK0796317T3 (en) | 1994-12-09 | 2000-06-05 | Procter & Gamble | Diacyl peroxide particle-containing composition for automatic washing |
US5534179A (en) | 1995-02-03 | 1996-07-09 | Procter & Gamble | Detergent compositions comprising multiperacid-forming bleach activators |
US5574005A (en) | 1995-03-07 | 1996-11-12 | The Procter & Gamble Company | Process for producing detergent agglomerates from high active surfactant pastes having non-linear viscoelastic properties |
US5569645A (en) | 1995-04-24 | 1996-10-29 | The Procter & Gamble Company | Low dosage detergent composition containing optimum proportions of agglomerates and spray dried granules for improved flow properties |
US5597936A (en) | 1995-06-16 | 1997-01-28 | The Procter & Gamble Company | Method for manufacturing cobalt catalysts |
WO1997000312A1 (en) | 1995-06-16 | 1997-01-03 | The Procter & Gamble Company | Automatic dishwashing compositions comprising cobalt catalysts |
US5565422A (en) | 1995-06-23 | 1996-10-15 | The Procter & Gamble Company | Process for preparing a free-flowing particulate detergent composition having improved solubility |
DE19530816A1 (en) | 1995-08-23 | 1997-02-27 | Cognis Bio Umwelt | Use of mutant subtilisin protease in cosmetic products |
US5576282A (en) | 1995-09-11 | 1996-11-19 | The Procter & Gamble Company | Color-safe bleach boosters, compositions and laundry methods employing same |
CZ292948B6 (en) | 1995-09-18 | 2004-01-14 | The Procter & Gamble Company | Delivery systems |
MA24136A1 (en) | 1996-04-16 | 1997-12-31 | Procter & Gamble | MANUFACTURE OF SURFACE AGENTS. |
NZ335932A (en) | 1996-11-21 | 2001-03-30 | Cor Therapeutics Inc | Use of a peptide agent such as a diphosphorylated peptide to modulate the interactions between myosin and integrins |
MA24733A1 (en) | 1997-03-07 | 1999-10-01 | Procter & Gamble | BLEACHING COMPOSITIONS CONTAINING A METAL BLEACHING CATALYST AND ORGANIC BLEACHING ACTIVATORS AND / OR ORGANIC PERCARBOXYLIC ACIDS |
ES2245020T3 (en) | 1997-03-07 | 2005-12-16 | THE PROCTER & GAMBLE COMPANY | IMPROVED METHODS OF PRODUCING MACROPOLICICLES WITH CROSSED BRIDGE. |
AR015977A1 (en) | 1997-10-23 | 2001-05-30 | Genencor Int | PROTEASA VARIANTS MULTIPLY SUBSTITUTED WITH ALTERED NET LOAD FOR USE IN DETERGENTS |
US5935826A (en) | 1997-10-31 | 1999-08-10 | National Starch And Chemical Investment Holding Corporation | Glucoamylase converted starch derivatives and their use as emulsifying and encapsulating agents |
US6287839B1 (en) | 1997-11-19 | 2001-09-11 | Genencor International, Inc. | Cellulase producing actinomycetes, cellulase produced therefrom and method of producing same |
WO1999027082A1 (en) | 1997-11-21 | 1999-06-03 | Novo Nordisk A/S | Protease variants and compositions |
JP4047545B2 (en) | 1998-06-10 | 2008-02-13 | ノボザイムス アクティーゼルスカブ | New mannanase |
CA2348893A1 (en) | 1998-11-30 | 2000-06-08 | The Procter & Gamble Company | Process for preparing cross-bridged tetraaza macrocycles |
PL200047B1 (en) * | 2000-02-08 | 2008-11-28 | Dsm Ip Assets Bv | Use of acid−stable proteases in animal feed |
US6440991B1 (en) | 2000-10-02 | 2002-08-27 | Wyeth | Ethers of 7-desmethlrapamycin |
DK1354056T3 (en) | 2000-10-10 | 2015-02-23 | Danisco Us Inc | IMPROVED secretion of a polypeptide by a microorganism |
CN1245523C (en) | 2001-07-14 | 2006-03-15 | 昆虫生命工学株式会社 | Method for preparing leather using protease and method for treating wastes dervied from leather processing using same |
WO2004072279A2 (en) * | 2003-02-07 | 2004-08-26 | Novozymes A/S | Proteases |
US7378256B2 (en) * | 2004-11-18 | 2008-05-27 | Genencor International, Inc. | Aspergillus niger promoter for expressing genes in host cells |
-
2004
- 2004-11-19 KR KR1020067012183A patent/KR101482015B1/en not_active IP Right Cessation
- 2004-11-19 DK DK04811731.1T patent/DK1694847T3/en active
- 2004-11-19 CN CN2013101397860A patent/CN103421760A/en active Pending
- 2004-11-19 KR KR1020137013997A patent/KR20130083461A/en not_active Application Discontinuation
- 2004-11-19 US US10/576,331 patent/US8535927B1/en not_active Expired - Fee Related
- 2004-11-19 EP EP04811731A patent/EP1694847B1/en not_active Expired - Lifetime
- 2004-11-19 BR BRPI0416797-0A patent/BRPI0416797A/en not_active IP Right Cessation
- 2004-11-19 AU AU2004293826A patent/AU2004293826B2/en not_active Ceased
- 2004-11-19 WO PCT/US2004/039006 patent/WO2005052161A2/en active Application Filing
- 2004-11-19 CN CN200480040520.XA patent/CN1906303B/en not_active Expired - Fee Related
- 2004-11-19 JP JP2006541585A patent/JP5244317B2/en not_active Expired - Fee Related
- 2004-11-19 WO PCT/US2004/039066 patent/WO2005052146A2/en active Application Filing
- 2004-11-19 CA CA002546451A patent/CA2546451A1/en not_active Abandoned
-
2009
- 2009-12-16 AU AU2009250976A patent/AU2009250976B2/en not_active Ceased
Patent Citations (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB1372034A (en) | 1970-12-31 | 1974-10-30 | Unilever Ltd | Detergent compositions |
EP0214761A2 (en) | 1985-08-07 | 1987-03-18 | Novo Nordisk A/S | An enzymatic detergent additive, a detergent, and a washing method |
EP0218272A1 (en) | 1985-08-09 | 1987-04-15 | Gist-Brocades N.V. | Novel lipolytic enzymes and their use in detergent compositions |
EP0238023A2 (en) | 1986-03-17 | 1987-09-23 | Novo Nordisk A/S | Process for the production of protein products in Aspergillus oryzae and a promoter for use in Aspergillus |
EP0258068A2 (en) | 1986-08-29 | 1988-03-02 | Novo Nordisk A/S | Enzymatic detergent additive |
EP0305216A1 (en) | 1987-08-28 | 1989-03-01 | Novo Nordisk A/S | Recombinant Humicola lipase and process for the production of recombinant humicola lipases |
EP0331376A2 (en) | 1988-02-28 | 1989-09-06 | Amano Pharmaceutical Co., Ltd. | Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it |
WO1996034946A1 (en) | 1995-05-05 | 1996-11-07 | Novo Nordisk A/S | Protease variants and compositions |
WO1999034011A2 (en) | 1997-12-24 | 1999-07-08 | Genencor International, Inc. | Method of assaying for a preferred enzyme and/or detergent |
US6376450B1 (en) | 1998-10-23 | 2002-04-23 | Chanchal Kumar Ghosh | Cleaning compositions containing multiply-substituted protease variants |
WO2002014490A2 (en) | 2000-08-11 | 2002-02-21 | Genencor International, Inc. | Bacillus transformation, transformants and mutant libraries |
WO2002050245A2 (en) | 2000-12-18 | 2002-06-27 | Genencor International, Inc. | Novel cellulase producing actinomycetes, cellulase produced therefrom and method of producing same |
Non-Patent Citations (13)
Title |
---|
"Molecular Biological Methods for Bacillus", 1990, JOHN WILEY AND SONS |
AUSTIN PRIEST: "Modern Bacterial Taxonomy", 1986, VAN NOSTRAND REINHOLD, pages: 37 |
DARTOIS ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 1131, 1993, pages 253 - 260 |
DEL MAR ET AL., ANAL. BIOCHEM., vol. 99, 1979, pages 316 - 320 |
DEVEREUX ET AL., NUCL. ACID RES., vol. 12, 1984, pages 387 - 395 |
KALISZ: "Advances in Biochemical Enoineerina/Biotechnoloov.", 1988, article "Microbial Proteinases" |
KARLIN, ALTSCHUL, PROC. NAT'L. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787 |
KRAUT, ANN. REV. BIOCHEM., vol. 46, 1977, pages 331 - 358 |
NEEDLEMAN, WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
NEIDHARDT ET AL., J. BACTERIOL., vol. 119, 1974, pages 736 - 747 |
PEARSON, LIPMAN, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
SMITH, WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
STROUD, SCI. AMER., vol. 131, pages 74 - 88 |
Cited By (649)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7985569B2 (en) | 2003-11-19 | 2011-07-26 | Danisco Us Inc. | Cellulomonas 69B4 serine protease variants |
US8648015B2 (en) | 2006-06-23 | 2014-02-11 | Danisco Us Inc. | Systematic evaluation of sequence and activity relationships using site evaluation libraries for engineering multiple properties |
WO2008048392A1 (en) * | 2006-10-19 | 2008-04-24 | Danisco Us, Inc., Genencor Division | Multiple mutation variants of serine protease |
JP2010506590A (en) * | 2006-10-19 | 2010-03-04 | ダニスコ・ユーエス・インク、ジェネンコー・ディビジョン | Variants with multiple mutations of serine protease |
RU2558261C2 (en) * | 2006-10-19 | 2015-07-27 | ДАНИСКО ЮЭс, ИНК., ДЖЕНЕНКОР ДИВИЖН | Versions of serine protease with multiple mutations |
JP2010519894A (en) * | 2007-03-01 | 2010-06-10 | ノボ・ノルデイスク・エー/エス | Protein expression in E. coli |
US9133425B2 (en) | 2007-06-06 | 2015-09-15 | Danisco Us Inc. | Methods for improving multiple protein properties |
JP2010528657A (en) * | 2007-06-06 | 2010-08-26 | ダニスコ・ユーエス・インク、ジェネンコー・ディビジョン | Methods for improving protein properties |
JP2014221044A (en) * | 2007-06-06 | 2014-11-27 | ダニスコ・ユーエス・インク、ジェネンコー・ディビジョン | Method for improving protein properties |
WO2008153934A3 (en) * | 2007-06-06 | 2009-02-05 | Danisco Us Inc Genencor Div | Methods for improving protein performance |
WO2008153934A2 (en) * | 2007-06-06 | 2008-12-18 | Danisco Us, Inc., Genencor Division | Methods for improving protein performance |
JP2010529842A (en) * | 2007-06-06 | 2010-09-02 | ダニスコ・ユーエス・インク、ジェネンコー・ディビジョン | Methods for improving protein performance |
US7618801B2 (en) | 2007-10-30 | 2009-11-17 | Danison US Inc. | Streptomyces protease |
RU2486244C2 (en) * | 2007-10-30 | 2013-06-27 | ДАНИСКО ЮЭс ИНК. | PROTEASE Streptomyces |
WO2009058679A1 (en) | 2007-10-30 | 2009-05-07 | Danisco Us Inc., Genencor Division | Streptomyces protease |
US7879788B2 (en) | 2007-10-30 | 2011-02-01 | Danisco Us Inc. | Methods of cleaning using a streptomyces 1AG3 serine protease |
US8066818B2 (en) | 2008-02-08 | 2011-11-29 | The Procter & Gamble Company | Water-soluble pouch |
EP2345599A1 (en) | 2008-02-08 | 2011-07-20 | The Procter & Gamble Company | Water-soluble pouch |
EP3067410A2 (en) | 2008-02-15 | 2016-09-14 | The Procter and Gamble Company | Cleaning compositions |
EP2660308A2 (en) | 2008-03-14 | 2013-11-06 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3208327A1 (en) | 2008-03-14 | 2017-08-23 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
DE202008018427U1 (en) | 2008-03-14 | 2013-09-17 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
DE202008018427U9 (en) | 2008-03-14 | 2015-10-29 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP2100949A1 (en) | 2008-03-14 | 2009-09-16 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP2660307A2 (en) | 2008-03-14 | 2013-11-06 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
US8680034B2 (en) | 2008-03-14 | 2014-03-25 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
US10844327B2 (en) | 2008-03-14 | 2020-11-24 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
US8980814B2 (en) | 2008-03-14 | 2015-03-17 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP2660309A2 (en) | 2008-03-14 | 2013-11-06 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP2100947A1 (en) | 2008-03-14 | 2009-09-16 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3660137A1 (en) | 2008-03-14 | 2020-06-03 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
US9528114B2 (en) | 2008-03-28 | 2016-12-27 | Danisco Us Inc. | Method for amplifying locus in bacterial cell |
US10563189B2 (en) | 2008-06-06 | 2020-02-18 | The Procter & Gamble Company | Compositions and methods comprising variant microbial proteases |
EP2166092A1 (en) | 2008-09-18 | 2010-03-24 | The Procter and Gamble Company | Detergent composition |
EP2166075A1 (en) | 2008-09-23 | 2010-03-24 | The Procter and Gamble Company | Cleaning composition |
EP2166073A1 (en) | 2008-09-23 | 2010-03-24 | The Procter & Gamble Company | Cleaning composition |
WO2010088162A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2213715A1 (en) | 2009-02-02 | 2010-08-04 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2213713A1 (en) | 2009-02-02 | 2010-08-04 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2213714A1 (en) | 2009-02-02 | 2010-08-04 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088161A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088159A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088158A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088163A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
US8575083B2 (en) | 2009-02-02 | 2013-11-05 | The Procter & Gamble Company | Liquid hand diswashing detergent composition |
EP3023483A1 (en) | 2009-02-02 | 2016-05-25 | The Procter and Gamble Company | Liquid hand diswashing detergent composition |
EP2216391A1 (en) | 2009-02-02 | 2010-08-11 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2216390A1 (en) | 2009-02-02 | 2010-08-11 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP2216392A1 (en) | 2009-02-02 | 2010-08-11 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
WO2010088164A1 (en) | 2009-02-02 | 2010-08-05 | The Procter & Gamble Company | Liquid hand dishwashing detergent composition |
EP3998328A1 (en) | 2009-02-09 | 2022-05-18 | The Procter & Gamble Company | Detergent composition |
EP2216393A1 (en) | 2009-02-09 | 2010-08-11 | The Procter & Gamble Company | Detergent composition |
WO2010090915A1 (en) | 2009-02-09 | 2010-08-12 | The Procter & Gamble Company | Detergent composition |
WO2011005804A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | Method of laundering fabric using a liquid laundry detergent composition |
WO2011005905A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | A mildly alkaline, low-built, solid fabric treatment detergent composition comprising phthalimido peroxy caproic acid |
WO2011005911A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | Method of laundering fabric using a compacted liquid laundry detergent composition |
WO2011005730A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | A catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte |
WO2011005917A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | Method of laundering fabric using a liquid laundry detergent composition |
WO2011005913A1 (en) | 2009-07-09 | 2011-01-13 | The Procter & Gamble Company | A catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte |
WO2011025615A2 (en) | 2009-08-13 | 2011-03-03 | The Procter & Gamble Company | Method of laundering fabrics at low temperature |
EP2292725A1 (en) | 2009-08-13 | 2011-03-09 | The Procter & Gamble Company | Method of laundering fabrics at low temperature |
EP3434764A2 (en) | 2009-12-09 | 2019-01-30 | The Procter & Gamble Company | Fabric and home care products |
WO2011072117A1 (en) | 2009-12-09 | 2011-06-16 | The Procter & Gamble Company | Fabric and home care products |
EP4159833A2 (en) | 2009-12-09 | 2023-04-05 | The Procter & Gamble Company | Fabric and home care products |
WO2011072017A2 (en) | 2009-12-10 | 2011-06-16 | The Procter & Gamble Company | Detergent composition |
WO2011071997A1 (en) | 2009-12-10 | 2011-06-16 | The Procter & Gamble Company | Automatic dishwashing product and use thereof |
WO2011071994A2 (en) | 2009-12-10 | 2011-06-16 | The Procter & Gamble Company | Detergent composition |
WO2011084319A1 (en) | 2009-12-10 | 2011-07-14 | The Procter & Gamble Company | Detergent composition |
US11078509B2 (en) | 2009-12-18 | 2021-08-03 | Novozymes, Inc. | Methods for producing polypeptides in protease-deficient mutants of Trichoderma |
US11001869B2 (en) | 2009-12-18 | 2021-05-11 | Novozymes, Inc. | Methods for producing polypeptides in protease-deficient mutants of Trichoderma |
US11078508B2 (en) | 2009-12-18 | 2021-08-03 | Novozymes, Inc. | Methods for producing polypeptides in protease-deficient mutants of trichoderma |
US11078510B2 (en) | 2009-12-18 | 2021-08-03 | Novozymes, Inc. | Methods for producing polypeptides in protease-deficient mutants of Trichoderma |
US10400260B2 (en) | 2009-12-18 | 2019-09-03 | Novozymes, Inc. | Protease-deficient mutants of trichoderma for producing polypeptides |
US11427847B2 (en) | 2009-12-18 | 2022-08-30 | Novozymes, Inc. | Methods for producing polypeptides in protease-deficient mutants of Trichoderma |
EP3404087A1 (en) | 2010-02-10 | 2018-11-21 | Novozymes A/S | Alpha-amylase variants with high stability in presence of a chelating agent |
EP3428260A2 (en) | 2010-02-10 | 2019-01-16 | The Procter & Gamble Company | Cleaning composition comprising amylase variants with high stability in the presence of a chelating agent |
EP3892709A2 (en) | 2010-02-10 | 2021-10-13 | Novozymes A/S | Variants and compositions comprising variants with high stability in presence of a chelating agent |
WO2011098531A1 (en) | 2010-02-10 | 2011-08-18 | Novozymes A/S | Variants and compositions comprising variants with high stability in presence of a chelating agent |
WO2011100410A2 (en) | 2010-02-10 | 2011-08-18 | The Procter & Gamble Company | Cleaning composition comprising amylase variants with high stability in the presence of a chelating agent |
EP3730595A2 (en) | 2010-02-10 | 2020-10-28 | The Procter & Gamble Company | Cleaning composition comprising amylase variants with high stability in the presence of a chelating agent |
EP2357220A1 (en) | 2010-02-10 | 2011-08-17 | The Procter & Gamble Company | Cleaning composition comprising amylase variants with high stability in the presence of a chelating agent |
WO2011100667A1 (en) | 2010-02-14 | 2011-08-18 | Ls9, Inc. | Surfactant and cleaning compositions comprising microbially produced branched fatty alcohols |
EP2361964A1 (en) | 2010-02-25 | 2011-08-31 | The Procter & Gamble Company | Detergent composition |
WO2011109318A1 (en) | 2010-03-01 | 2011-09-09 | 1/3The Procter & Gamble Company | Solid laundry detergent composition comprising c.i. fluorescent brightener 260 in alpha-crystalline form |
EP2365054A1 (en) | 2010-03-01 | 2011-09-14 | The Procter & Gamble Company | Solid laundry detergent composition comprising secondary alcohol-based detersive surfactant |
EP2363456A1 (en) | 2010-03-01 | 2011-09-07 | The Procter & Gamble Company | Solid laundry detergent composition comprising brightener in micronized particulate form |
WO2011109292A1 (en) | 2010-03-01 | 2011-09-09 | The Procter & Gamble Company | Solid laundry detergent composition comprising brightener in micronized particulate form |
WO2011109316A1 (en) | 2010-03-01 | 2011-09-09 | The Procter & Gamble Company | Solid laundry detergent composition having an excellent anti-encrustation profile |
WO2011109320A1 (en) | 2010-03-01 | 2011-09-09 | The Procter & Gamble Company | Solid laundry detergent composition comprising secondary alcohol - based detersive surfactant |
EP2365059A1 (en) | 2010-03-01 | 2011-09-14 | The Procter & Gamble Company | Solid laundry detergent composition comprising C.I. fluorescent brightener 260 in alpha-crystalline form |
EP2365058A1 (en) | 2010-03-01 | 2011-09-14 | The Procter & Gamble Company | Solid laundry detergent composition having an excellent anti-encrustation profile |
WO2011133371A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | Method of laundering fabric using a compacted liquid laundry detergent composition |
WO2011133285A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | Solid laundry detergent composition having a dynamic in-wash ph profile |
WO2011133372A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | Detergent composition |
WO2011133456A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | A liquid laundry detergent composition comprising a source of peracid and having a ph profile that is controlled with respect to the pka of the source of peracid |
EP2380957A1 (en) | 2010-04-19 | 2011-10-26 | The Procter & Gamble Company | Solid laundry detergent composition having a dynamic in-wash ph profile |
WO2011133380A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | A laundry detergent composition comprising bleach particles that are suspended within a continuous liquid phase |
WO2011133381A1 (en) | 2010-04-19 | 2011-10-27 | The Procter & Gamble Company | A mildly alkaline, low-built, solid fabric treatment detergent composition comprising perhydrolase |
EP2377914A1 (en) | 2010-04-19 | 2011-10-19 | The Procter & Gamble Company | Mildly alkaline, low-built, solid fabric treatment detergent composition comprising perhydrolase |
EP2380962A1 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Particle |
EP2380963A1 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Method of perfuming |
EP2380961A1 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Detergent composition |
EP2380481A2 (en) | 2010-04-23 | 2011-10-26 | The Procter & Gamble Company | Automatic dishwashing product |
WO2011133484A1 (en) | 2010-04-23 | 2011-10-27 | The Procter & Gamble Company | Detergent composition |
EP2383329A1 (en) | 2010-04-23 | 2011-11-02 | The Procter & Gamble Company | Particle |
WO2011133462A1 (en) | 2010-04-23 | 2011-10-27 | The Procter & Gamble Company | Particle |
WO2011133483A1 (en) | 2010-04-23 | 2011-10-27 | The Procter & Gamble Company | Particle |
WO2011156298A2 (en) | 2010-06-10 | 2011-12-15 | The Procter & Gamble Company | Solid detergent composition comprising lipase of bacterial origin |
EP2395071A1 (en) | 2010-06-10 | 2011-12-14 | The Procter & Gamble Company | Solid detergent composition comprising lipase of bacterial origin |
EP2395070A1 (en) | 2010-06-10 | 2011-12-14 | The Procter & Gamble Company | Liquid laundry detergent composition comprising lipase of bacterial origin |
WO2011156297A2 (en) | 2010-06-10 | 2011-12-15 | The Procter & Gamble Company | Compacted liquid laundry detergent composition comprising lipase of bacterial origin |
WO2011163457A1 (en) | 2010-06-23 | 2011-12-29 | The Procter & Gamble Company | Product for pre-treatment and laundering of stained fabric |
US8685171B2 (en) | 2010-07-29 | 2014-04-01 | The Procter & Gamble Company | Liquid detergent composition |
EP2412792A1 (en) | 2010-07-29 | 2012-02-01 | The Procter & Gamble Company | Liquid detergent composition |
WO2012015852A1 (en) | 2010-07-29 | 2012-02-02 | The Procter & Gamble Company | Liquid detergent composition |
WO2012016104A2 (en) | 2010-07-29 | 2012-02-02 | The Procter & Gamble Company | Liquid detergent composition |
US11840718B2 (en) | 2010-12-22 | 2023-12-12 | Novozymes A/S | Processes for producing ethanol |
WO2012151534A1 (en) | 2011-05-05 | 2012-11-08 | Danisco Us Inc. | Compositions and methods comprising serine protease variants |
EP4230735A1 (en) | 2011-05-05 | 2023-08-23 | Danisco US Inc. | Compositions and methods comprising serine protease variants |
WO2012151480A2 (en) | 2011-05-05 | 2012-11-08 | The Procter & Gamble Company | Compositions and methods comprising serine protease variants |
EP3486319A2 (en) | 2011-05-05 | 2019-05-22 | Danisco US Inc. | Compositions and methods comprising serine protease variants |
EP2537918A1 (en) | 2011-06-20 | 2012-12-26 | The Procter & Gamble Company | Consumer products with lipase comprising coated particles |
WO2013003025A1 (en) | 2011-06-20 | 2013-01-03 | The Procter & Gamble Company | Consumer products with lipase comprising coated particles |
WO2012177709A1 (en) | 2011-06-23 | 2012-12-27 | The Procter & Gamble Company | Product for pre-treatment and laundering of stained fabric |
EP2540824A1 (en) | 2011-06-30 | 2013-01-02 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants reference to a sequence listing |
EP3121270A2 (en) | 2011-06-30 | 2017-01-25 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants reference to a sequence listing |
US10752889B2 (en) | 2011-06-30 | 2020-08-25 | Novozymes A/S | Alpha-amylase variants |
US12012623B2 (en) | 2011-06-30 | 2024-06-18 | Novozymes A/S | Alpha-amylase variants |
US9434932B2 (en) | 2011-06-30 | 2016-09-06 | Novozymes A/S | Alpha-amylase variants |
EP2540825A2 (en) | 2011-06-30 | 2013-01-02 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants reference to a sequence listing |
US11091748B2 (en) | 2011-06-30 | 2021-08-17 | Novozymes A/S | Alpha-amylase variants |
US10167458B2 (en) | 2011-06-30 | 2019-01-01 | Novozymes A/S | Alpha-amylase variants |
WO2013003659A1 (en) | 2011-06-30 | 2013-01-03 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants reference to a sequence listing |
WO2013016368A1 (en) | 2011-07-25 | 2013-01-31 | The Procter & Gamble Company | Detergent compositions |
EP2551336A1 (en) | 2011-07-25 | 2013-01-30 | The Procter & Gamble Company | Detergent compositions |
EP2551335A1 (en) | 2011-07-25 | 2013-01-30 | The Procter & Gamble Company | Enzyme stabilized liquid detergent composition |
WO2013016030A1 (en) | 2011-07-27 | 2013-01-31 | The Procter & Gamble Company | Multiphase liquid detergent composition |
WO2013016031A1 (en) | 2011-07-27 | 2013-01-31 | The Procter & Gamble Company | Multiphase liquid detergent composition |
EP2584028A1 (en) | 2011-10-19 | 2013-04-24 | The Procter & Gamble Company | Particle |
WO2013059422A1 (en) | 2011-10-19 | 2013-04-25 | The Procter & Gamble Company | Particle |
US9801398B2 (en) | 2012-01-26 | 2017-10-31 | Novozymes A/S | Use of polypeptides having protease activity in animal feed and detergents |
WO2013110766A1 (en) | 2012-01-26 | 2013-08-01 | Novozymes A/S | Use of polypeptides having protease activity in animal feed and detergents |
EP2623586A2 (en) | 2012-02-03 | 2013-08-07 | The Procter & Gamble Company | Compositions and methods for surface treatment with lipases |
WO2013116261A2 (en) | 2012-02-03 | 2013-08-08 | The Procter & Gamble Company | Compositions and methods for surface treatment with lipases |
WO2013006871A2 (en) | 2012-02-13 | 2013-01-10 | Milliken & Company | Laundry care compositions containing dyes |
WO2013142495A1 (en) | 2012-03-19 | 2013-09-26 | Milliken & Company | Carboxylate dyes |
WO2013142486A1 (en) | 2012-03-19 | 2013-09-26 | The Procter & Gamble Company | Laundry care compositions containing dyes |
WO2013149858A1 (en) | 2012-04-02 | 2013-10-10 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2013171241A1 (en) | 2012-05-16 | 2013-11-21 | Novozymes A/S | Compositions comprising lipase and methods of use thereof |
WO2013188331A1 (en) | 2012-06-11 | 2013-12-19 | The Procter & Gamble Company | Detergent composition |
EP2674475A1 (en) | 2012-06-11 | 2013-12-18 | The Procter & Gamble Company | Detergent composition |
EP2674476A1 (en) | 2012-06-11 | 2013-12-18 | The Procter & Gamble Company | Detergent composition |
WO2013189972A3 (en) * | 2012-06-20 | 2014-02-20 | Novozymes A/S | Use of polypeptides having protease activity in animal feed and detergents |
WO2013189972A2 (en) | 2012-06-20 | 2013-12-27 | Novozymes A/S | Use of polypeptides having protease activity in animal feed and detergents |
WO2014009473A1 (en) | 2012-07-12 | 2014-01-16 | Novozymes A/S | Polypeptides having lipase activity and polynucleotides encoding same |
WO2014029821A1 (en) | 2012-08-22 | 2014-02-27 | Novozymes A/S | Metalloproteases from alicyclobacillus sp. |
WO2014029820A1 (en) | 2012-08-22 | 2014-02-27 | Novozymes A/S | Detergent compositions comprising metalloproteases |
WO2014029819A1 (en) | 2012-08-22 | 2014-02-27 | Novozymes A/S | Metalloprotease from exiguobacterium |
EP3556836A1 (en) | 2012-12-07 | 2019-10-23 | Novozymes A/S | Preventing adhesion of bacteria |
WO2014087011A1 (en) | 2012-12-07 | 2014-06-12 | Novozymes A/S | Preventing adhesion of bacteria |
WO2014100100A1 (en) | 2012-12-20 | 2014-06-26 | The Procter & Gamble Company | Detergent composition with silicate coated bleach |
WO2014096259A1 (en) | 2012-12-21 | 2014-06-26 | Novozymes A/S | Polypeptides having protease activiy and polynucleotides encoding same |
US9551042B2 (en) | 2012-12-21 | 2017-01-24 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
EP3321360A2 (en) | 2013-01-03 | 2018-05-16 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
WO2014122161A3 (en) * | 2013-02-06 | 2014-11-20 | Novozymes A/S | Use of polypeptides having protease activity in animal feed |
WO2014122161A2 (en) | 2013-02-06 | 2014-08-14 | Novozymes A/S | Polypeptides having protease activity |
WO2014138141A1 (en) | 2013-03-05 | 2014-09-12 | The Procter & Gamble Company | Mixed sugar compositions |
WO2014147127A1 (en) | 2013-03-21 | 2014-09-25 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2014160820A1 (en) | 2013-03-28 | 2014-10-02 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2014160821A1 (en) | 2013-03-28 | 2014-10-02 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine, a soil release polymer, and a carboxymethylcellulose |
WO2014184164A1 (en) | 2013-05-14 | 2014-11-20 | Novozymes A/S | Detergent compositions |
WO2014183921A1 (en) | 2013-05-17 | 2014-11-20 | Novozymes A/S | Polypeptides having alpha amylase activity |
US10060073B2 (en) * | 2013-05-23 | 2018-08-28 | Washing Systems, Llc | Method of laundering industrial garments |
US20140345062A1 (en) * | 2013-05-23 | 2014-11-27 | Washing Systems, Llc | Method of laundering industrial garments |
EP3699256A1 (en) | 2013-05-28 | 2020-08-26 | The Procter & Gamble Company | Surface treatment compositions comprising photochromic dyes |
WO2014193859A1 (en) | 2013-05-28 | 2014-12-04 | The Procter & Gamble Company | Surface treatment compositions comprising photochromic dyes |
EP2808372A1 (en) | 2013-05-28 | 2014-12-03 | The Procter and Gamble Company | Surface treatment compositions comprising photochromic dyes |
EP3786269A1 (en) | 2013-06-06 | 2021-03-03 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
US11939552B2 (en) | 2013-06-24 | 2024-03-26 | Novozymes A/S | Process of recovering oil |
US11965143B2 (en) | 2013-06-24 | 2024-04-23 | Novozymes A/S | Process of recovering oil |
WO2014207227A1 (en) | 2013-06-27 | 2014-12-31 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
WO2014207224A1 (en) | 2013-06-27 | 2014-12-31 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
WO2015001017A2 (en) | 2013-07-04 | 2015-01-08 | Novozymes A/S | Polypeptides having anti-redeposition effect and polynucleotides encoding same |
WO2015004102A1 (en) | 2013-07-09 | 2015-01-15 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
EP3611260A1 (en) | 2013-07-29 | 2020-02-19 | Novozymes A/S | Protease variants and polynucleotides encoding same |
EP3309249A1 (en) | 2013-07-29 | 2018-04-18 | Novozymes A/S | Protease variants and polynucleotides encoding same |
EP3613853A1 (en) | 2013-07-29 | 2020-02-26 | Novozymes A/S | Protease variants and polynucleotides encoding same |
EP4477734A2 (en) | 2013-07-29 | 2024-12-18 | Novozymes A/S | Protease variants and polynucleotides encoding same |
EP3339377A1 (en) | 2013-09-18 | 2018-06-27 | Milliken & Company | Laundry care composition comprising carboxylate dye |
WO2015042209A1 (en) | 2013-09-18 | 2015-03-26 | The Procter & Gamble Company | Laundry care compositions containing thiophene azo carboxylate dyes |
WO2015042087A1 (en) | 2013-09-18 | 2015-03-26 | The Procter & Gamble Company | Laundry care composition comprising carboxylate dye |
WO2015041887A2 (en) | 2013-09-18 | 2015-03-26 | Milliken & Company | Laundry care composition comprising carboxylate dye |
WO2015042086A1 (en) | 2013-09-18 | 2015-03-26 | The Procter & Gamble Company | Laundry care composition comprising carboxylate dye |
EP4047058A1 (en) | 2013-09-18 | 2022-08-24 | Milliken & Company | Laundry care composition comprising a carboxylate dye |
WO2015049370A1 (en) | 2013-10-03 | 2015-04-09 | Novozymes A/S | Detergent composition and use of detergent composition |
EP2857487A1 (en) | 2013-10-07 | 2015-04-08 | WeylChem Switzerland AG | Multi-compartment pouch comprising cleaning compositions, washing process and use for washing and cleaning of textiles and dishes |
EP2857485A1 (en) | 2013-10-07 | 2015-04-08 | WeylChem Switzerland AG | Multi-compartment pouch comprising alkanolamine-free cleaning compositions, washing process and use for washing and cleaning of textiles and dishes |
EP2857486A1 (en) | 2013-10-07 | 2015-04-08 | WeylChem Switzerland AG | Multi-compartment pouch comprising cleaning compositions, washing process and use for washing and cleaning of textiles and dishes |
WO2015051901A1 (en) | 2013-10-07 | 2015-04-16 | Weylchem Wiesbaden Gmbh | Multi-compartment pouch comprising alkanolamine-free cleaning compositions, washing process and use for washing and cleaning of textiles and dishes |
EP3453757A1 (en) | 2013-12-20 | 2019-03-13 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
WO2015112339A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Fabric treatment composition |
WO2015112338A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Method of treating textile fabrics |
WO2015112341A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Fabric treatment composition |
WO2015109972A1 (en) | 2014-01-22 | 2015-07-30 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2015112340A1 (en) | 2014-01-22 | 2015-07-30 | The Procter & Gamble Company | Method of treating textile fabrics |
US9725685B2 (en) | 2014-01-30 | 2017-08-08 | The Procter & Gamble Company | Unit dose article |
WO2015130669A1 (en) | 2014-02-25 | 2015-09-03 | The Procter & Gamble Company | A process for making renewable surfactant intermediates and surfactants from fats and oils and products thereof |
WO2015130653A1 (en) | 2014-02-25 | 2015-09-03 | The Procter & Gamble Company | A process for making renewable surfactant intermediates and surfactants from fats and oils and products thereof |
WO2015134729A1 (en) | 2014-03-05 | 2015-09-11 | Novozymes A/S | Compositions and methods for improving properties of non-cellulosic textile materials with xyloglucan endotransglycosylase |
WO2015134737A1 (en) | 2014-03-05 | 2015-09-11 | Novozymes A/S | Compositions and methods for improving properties of cellulosic textile materials with xyloglucan endotransglycosylase |
EP3521434A1 (en) | 2014-03-12 | 2019-08-07 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2015148361A1 (en) | 2014-03-27 | 2015-10-01 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2015148360A1 (en) | 2014-03-27 | 2015-10-01 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
EP2924105A1 (en) | 2014-03-28 | 2015-09-30 | The Procter and Gamble Company | Water soluble unit dose article |
EP2924106A1 (en) | 2014-03-28 | 2015-09-30 | The Procter and Gamble Company | Water soluble unit dose article |
EP2924108A1 (en) | 2014-03-28 | 2015-09-30 | The Procter and Gamble Company | Water soluble unit dose article |
EP2924107A1 (en) | 2014-03-28 | 2015-09-30 | The Procter and Gamble Company | Water soluble unit dose article |
WO2015148777A1 (en) | 2014-03-28 | 2015-10-01 | The Procter & Gamble Company | Water soluble unit dose article |
WO2015148780A1 (en) | 2014-03-28 | 2015-10-01 | The Procter & Gamble Company | Water soluble unit dose article |
WO2015150457A1 (en) | 2014-04-01 | 2015-10-08 | Novozymes A/S | Polypeptides having alpha amylase activity |
EP3722406A1 (en) | 2014-04-11 | 2020-10-14 | Novozymes A/S | Detergent composition |
WO2015158237A1 (en) | 2014-04-15 | 2015-10-22 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2015171592A1 (en) | 2014-05-06 | 2015-11-12 | Milliken & Company | Laundry care compositions |
WO2015181119A2 (en) | 2014-05-27 | 2015-12-03 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
EP3878957A1 (en) | 2014-05-27 | 2021-09-15 | Novozymes A/S | Methods for producing lipases |
EP3760713A2 (en) | 2014-05-27 | 2021-01-06 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2015187757A1 (en) | 2014-06-06 | 2015-12-10 | The Procter & Gamble Company | Detergent composition comprising polyalkyleneimine polymers |
WO2015189371A1 (en) | 2014-06-12 | 2015-12-17 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
EP3739029A1 (en) | 2014-07-04 | 2020-11-18 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
EP3878960A1 (en) | 2014-07-04 | 2021-09-15 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
WO2016044200A1 (en) | 2014-09-15 | 2016-03-24 | The Procter & Gamble Company | Detergent compositions containing salts of polyetheramines and polymeric acid |
WO2016048969A1 (en) | 2014-09-25 | 2016-03-31 | The Procter & Gamble Company | Detergent compositions containing a polyetheramine and an anionic soil release polymer |
WO2016048674A1 (en) | 2014-09-25 | 2016-03-31 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2016049387A1 (en) | 2014-09-26 | 2016-03-31 | The Procter & Gamble Company | Cleaning compositions containing a polyetheramine |
WO2016069548A3 (en) * | 2014-10-27 | 2016-06-30 | Danisco Us Inc. | Serine proteases |
US12146173B2 (en) | 2014-10-27 | 2024-11-19 | Danisco Us Inc. | Serine proteases |
WO2016069544A1 (en) * | 2014-10-27 | 2016-05-06 | Danisco Us Inc. | Serine proteases |
WO2016081437A1 (en) | 2014-11-17 | 2016-05-26 | The Procter & Gamble Company | Benefit agent delivery compositions |
WO2016079110A2 (en) | 2014-11-19 | 2016-05-26 | Novozymes A/S | Use of enzyme for cleaning |
EP4067485A2 (en) | 2014-12-05 | 2022-10-05 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2016087401A1 (en) | 2014-12-05 | 2016-06-09 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
US10760036B2 (en) | 2014-12-15 | 2020-09-01 | Henkel Ag & Co. Kgaa | Detergent composition comprising subtilase variants |
EP3608403A2 (en) | 2014-12-15 | 2020-02-12 | Henkel AG & Co. KGaA | Detergent composition comprising subtilase variants |
WO2016096996A1 (en) | 2014-12-16 | 2016-06-23 | Novozymes A/S | Polypeptides having n-acetyl glucosamine oxidase activity |
EP3741849A2 (en) | 2014-12-19 | 2020-11-25 | Novozymes A/S | Protease variants and polynucleotides encoding same |
EP3741848A2 (en) | 2014-12-19 | 2020-11-25 | Novozymes A/S | Protease variants and polynucleotides encoding same |
WO2016162556A1 (en) | 2015-04-10 | 2016-10-13 | Novozymes A/S | Laundry method, use of dnase and detergent composition |
WO2016162558A1 (en) | 2015-04-10 | 2016-10-13 | Novozymes A/S | Detergent composition |
EP3088503A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
EP3088502A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
EP3088504A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
EP3088505A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Method of treating a fabric |
WO2016176240A1 (en) | 2015-04-29 | 2016-11-03 | The Procter & Gamble Company | Method of treating a fabric |
WO2016176282A1 (en) | 2015-04-29 | 2016-11-03 | The Procter & Gamble Company | Method of treating a fabric |
WO2016176280A1 (en) | 2015-04-29 | 2016-11-03 | The Procter & Gamble Company | Method of treating a fabric |
WO2016176241A1 (en) | 2015-04-29 | 2016-11-03 | The Procter & Gamble Company | Detergent composition |
EP3088506A1 (en) | 2015-04-29 | 2016-11-02 | The Procter and Gamble Company | Detergent composition |
WO2016176296A1 (en) | 2015-04-29 | 2016-11-03 | The Procter & Gamble Company | Method of laundering a fabric |
WO2016178668A1 (en) | 2015-05-04 | 2016-11-10 | Milliken & Company | Leuco triphenylmethane colorants as bluing agents in laundry care compositions |
WO2016184944A1 (en) | 2015-05-19 | 2016-11-24 | Novozymes A/S | Odor reduction |
WO2016192905A1 (en) | 2015-06-02 | 2016-12-08 | Unilever Plc | Laundry detergent composition |
WO2016196874A1 (en) | 2015-06-04 | 2016-12-08 | The Procter & Gamble Company | Hand dishwashing liquid detergent composition |
EP3287513A1 (en) | 2015-06-04 | 2018-02-28 | The Procter & Gamble Company | Hand dishwashing liquid detergent composition |
EP3284811A1 (en) | 2015-06-04 | 2018-02-21 | The Procter & Gamble Company | Hand dishwashing liquid detergent composition |
EP3101108A1 (en) | 2015-06-04 | 2016-12-07 | The Procter and Gamble Company | Hand dishwashing liquid detergent composition |
EP3101109A1 (en) | 2015-06-04 | 2016-12-07 | The Procter and Gamble Company | Hand dishwashing liquid detergent composition |
WO2016196872A1 (en) | 2015-06-04 | 2016-12-08 | The Procter & Gamble Company | Hand dishwashing liquid detergent composition |
US10377973B2 (en) | 2015-06-04 | 2019-08-13 | The Procter & Gamble Company | Hand dishwashing liquid detergent composition |
US10377974B2 (en) | 2015-06-04 | 2019-08-13 | The Procter & Gamble Company | Hand dishwashing liquid detergent composition |
WO2016198262A1 (en) | 2015-06-11 | 2016-12-15 | Unilever Plc | Laundry detergent composition |
WO2016202739A1 (en) | 2015-06-16 | 2016-12-22 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
WO2016202785A1 (en) | 2015-06-17 | 2016-12-22 | Novozymes A/S | Container |
WO2016206837A1 (en) | 2015-06-26 | 2016-12-29 | Unilever Plc | Laundry detergent composition |
WO2016135351A1 (en) | 2015-06-30 | 2016-09-01 | Novozymes A/S | Laundry detergent composition, method for washing and use of composition |
EP3929285A2 (en) | 2015-07-01 | 2021-12-29 | Novozymes A/S | Methods of reducing odor |
EP3950939A2 (en) | 2015-07-06 | 2022-02-09 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2017046260A1 (en) | 2015-09-17 | 2017-03-23 | Novozymes A/S | Polypeptides having xanthan degrading activity and polynucleotides encoding same |
WO2017046232A1 (en) | 2015-09-17 | 2017-03-23 | Henkel Ag & Co. Kgaa | Detergent compositions comprising polypeptides having xanthan degrading activity |
EP3708660A2 (en) | 2015-10-07 | 2020-09-16 | Novozymes A/S | Polypeptides |
WO2017060505A1 (en) | 2015-10-07 | 2017-04-13 | Novozymes A/S | Polypeptides |
WO2017064253A1 (en) | 2015-10-14 | 2017-04-20 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
EP4324919A2 (en) | 2015-10-14 | 2024-02-21 | Novozymes A/S | Polypeptide variants |
WO2017064269A1 (en) | 2015-10-14 | 2017-04-20 | Novozymes A/S | Polypeptide variants |
WO2017066510A1 (en) | 2015-10-14 | 2017-04-20 | Novozymes A/S | Cleaning of water filtration membranes |
EP3957711A2 (en) | 2015-10-28 | 2022-02-23 | Novozymes A/S | Detergent composition comprising amylase and protease variants |
WO2017089366A1 (en) | 2015-11-24 | 2017-06-01 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
WO2017091674A1 (en) | 2015-11-26 | 2017-06-01 | The Procter & Gamble Company | Liquid detergent compositions comprising protease and encapsulated lipase |
EP3173467A1 (en) | 2015-11-26 | 2017-05-31 | The Procter & Gamble Company | Cleaning compositions comprising enzymes |
WO2017093318A1 (en) | 2015-12-01 | 2017-06-08 | Novozymes A/S | Methods for producing lipases |
US11441140B2 (en) | 2015-12-07 | 2022-09-13 | Henkel Ag & Co. Kgaa | Dishwashing compositions comprising polypeptides having beta-glucanase activity and uses thereof |
WO2017129754A1 (en) | 2016-01-29 | 2017-08-03 | Novozymes A/S | Beta-glucanase variants and polynucleotides encoding same |
WO2017137293A1 (en) | 2016-02-12 | 2017-08-17 | Basf Se | Process for preparation of microcapsules |
EP3205392A1 (en) | 2016-02-12 | 2017-08-16 | Basf Se | Microcapsules and process for preparation of microcapsules |
EP3205393A1 (en) | 2016-02-12 | 2017-08-16 | Basf Se | Process for preparation of microcapsules |
WO2017140391A1 (en) | 2016-02-17 | 2017-08-24 | Unilever Plc | Whitening composition |
WO2017140392A1 (en) | 2016-02-17 | 2017-08-24 | Unilever Plc | Whitening composition |
WO2017162378A1 (en) | 2016-03-21 | 2017-09-28 | Unilever Plc | Laundry detergent composition |
EP3715442A1 (en) | 2016-03-23 | 2020-09-30 | Novozymes A/S | Use of polypeptide having dnase activity for treating fabrics |
WO2017174251A1 (en) | 2016-04-08 | 2017-10-12 | Unilever Plc | Laundry detergent composition |
WO2017174769A2 (en) | 2016-04-08 | 2017-10-12 | Novozymes A/S | Detergent compositions and uses of the same |
WO2017182295A1 (en) | 2016-04-18 | 2017-10-26 | Basf Se | Liquid cleaning compositions |
WO2017186943A1 (en) | 2016-04-29 | 2017-11-02 | Novozymes A/S | Detergent compositions and uses thereof |
EP3693449A1 (en) | 2016-04-29 | 2020-08-12 | Novozymes A/S | Detergent compositions and uses thereof |
WO2017220422A1 (en) | 2016-06-23 | 2017-12-28 | Novozymes A/S | Use of enzymes, composition and method for removing soil |
WO2018001959A1 (en) | 2016-06-30 | 2018-01-04 | Novozymes A/S | Lipase variants and compositions comprising surfactant and lipase variant |
WO2018002261A1 (en) | 2016-07-01 | 2018-01-04 | Novozymes A/S | Detergent compositions |
WO2018007435A1 (en) | 2016-07-05 | 2018-01-11 | Novozymes A/S | Pectate lyase variants and polynucleotides encoding same |
WO2018007573A1 (en) | 2016-07-08 | 2018-01-11 | Novozymes A/S | Detergent compositions with galactanase |
WO2018011276A1 (en) | 2016-07-13 | 2018-01-18 | The Procter & Gamble Company | Bacillus cibi dnase variants and uses thereof |
EP3950941A2 (en) | 2016-07-13 | 2022-02-09 | Novozymes A/S | Dnase polypeptide variants |
WO2018011277A1 (en) | 2016-07-13 | 2018-01-18 | Novozymes A/S | Bacillus cibi dnase variants |
EP4357453A2 (en) | 2016-07-18 | 2024-04-24 | Novozymes A/S | Lipase variants, polynucleotides encoding same and the use thereof |
WO2018015295A1 (en) | 2016-07-18 | 2018-01-25 | Novozymes A/S | Lipase variants, polynucleotides encoding same and the use thereof |
EP3275985A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275987A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275989A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275986A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3275988A1 (en) | 2016-07-26 | 2018-01-31 | The Procter and Gamble Company | Automatic dishwashing detergent composition |
EP3284805A1 (en) | 2016-08-17 | 2018-02-21 | The Procter & Gamble Company | Cleaning composition comprising enzymes |
WO2018034842A1 (en) | 2016-08-17 | 2018-02-22 | The Procter & Gamble Company | Cleaning composition comprising enzymes |
WO2018060216A1 (en) | 2016-09-29 | 2018-04-05 | Novozymes A/S | Use of enzyme for washing, method for washing and warewashing composition |
WO2018077938A1 (en) | 2016-10-25 | 2018-05-03 | Novozymes A/S | Detergent compositions |
WO2018085315A1 (en) | 2016-11-01 | 2018-05-11 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care compositions, packaging, kits and methods thereof |
WO2018085390A1 (en) | 2016-11-01 | 2018-05-11 | Milliken & Company | Leuco colorants as bluing agents in laundry care compositions |
WO2018083093A1 (en) | 2016-11-01 | 2018-05-11 | Novozymes A/S | Multi-core granules |
WO2018085310A1 (en) | 2016-11-01 | 2018-05-11 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care compositions |
WO2018084930A1 (en) | 2016-11-03 | 2018-05-11 | Milliken & Company | Leuco triphenylmethane colorants as bluing agents in laundry care compositions |
EP4001389A1 (en) | 2016-12-02 | 2022-05-25 | The Procter & Gamble Company | Cleaning compositions including enzymes |
WO2018102479A1 (en) | 2016-12-02 | 2018-06-07 | The Procter & Gamble Company | Cleaning compositions including enzymes |
WO2018102478A1 (en) | 2016-12-02 | 2018-06-07 | The Procter & Gamble Company | Cleaning compositions including enzymes |
EP3330348A1 (en) | 2016-12-02 | 2018-06-06 | The Procter & Gamble Company | Cleaning compositions including enzymes |
WO2018108865A1 (en) | 2016-12-12 | 2018-06-21 | Novozymes A/S | Use of polypeptides |
WO2018108382A1 (en) | 2016-12-15 | 2018-06-21 | Unilever Plc | Laundry detergent composition |
EP3339423A1 (en) | 2016-12-22 | 2018-06-27 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2018144399A1 (en) | 2017-02-01 | 2018-08-09 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants |
US12173260B2 (en) | 2017-02-01 | 2024-12-24 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants |
EP3357994A1 (en) | 2017-02-01 | 2018-08-08 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants |
WO2018178061A1 (en) | 2017-03-31 | 2018-10-04 | Novozymes A/S | Polypeptides having rnase activity |
WO2018177938A1 (en) | 2017-03-31 | 2018-10-04 | Novozymes A/S | Polypeptides having dnase activity |
WO2018177936A1 (en) | 2017-03-31 | 2018-10-04 | Novozymes A/S | Polypeptides having dnase activity |
WO2018185048A1 (en) | 2017-04-03 | 2018-10-11 | Novozymes A/S | Recovery process |
WO2018185181A1 (en) | 2017-04-04 | 2018-10-11 | Novozymes A/S | Glycosyl hydrolases |
WO2018185150A1 (en) | 2017-04-04 | 2018-10-11 | Novozymes A/S | Polypeptides |
WO2018185152A1 (en) | 2017-04-04 | 2018-10-11 | Novozymes A/S | Polypeptide compositions and uses thereof |
EP3385362A1 (en) | 2017-04-05 | 2018-10-10 | Henkel AG & Co. KGaA | Detergent compositions comprising fungal mannanases |
WO2018184767A1 (en) | 2017-04-05 | 2018-10-11 | Henkel Ag & Co. Kgaa | Detergent compositions comprising bacterial mannanases |
EP3385361A1 (en) | 2017-04-05 | 2018-10-10 | Henkel AG & Co. KGaA | Detergent compositions comprising bacterial mannanases |
WO2018185280A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018185269A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018184818A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018184817A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018184816A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018185285A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
EP3626809A1 (en) | 2017-04-06 | 2020-03-25 | Novozymes A/S | Cleaning compositions and uses thereof |
EP3967756A1 (en) | 2017-04-06 | 2022-03-16 | Novozymes A/S | Detergent compositions and uses thereof |
WO2018184873A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Detergent compositions and uses thereof |
WO2018185267A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2018202846A1 (en) | 2017-05-05 | 2018-11-08 | Novozymes A/S | Compositions comprising lipase and sulfite |
WO2018224544A1 (en) | 2017-06-08 | 2018-12-13 | Novozymes A/S | Compositions comprising polypeptides having cellulase activity and amylase activity, and uses thereof in cleaning and detergent compositions |
WO2019008036A1 (en) | 2017-07-07 | 2019-01-10 | Unilever Plc | Whitening composition |
WO2019008035A1 (en) | 2017-07-07 | 2019-01-10 | Unilever Plc | Laundry cleaning composition |
WO2019057758A1 (en) | 2017-09-20 | 2019-03-28 | Novozymes A/S | Use of enzymes for improving water absorption and/or whiteness |
WO2019057902A1 (en) | 2017-09-22 | 2019-03-28 | Novozymes A/S | Novel polypeptides |
WO2019063499A1 (en) | 2017-09-27 | 2019-04-04 | Novozymes A/S | Lipase variants and microcapsule compositions comprising such lipase variants |
WO2019067390A1 (en) | 2017-09-27 | 2019-04-04 | The Procter & Gamble Company | Detergent compositions comprising lipases |
WO2019068715A1 (en) | 2017-10-02 | 2019-04-11 | Novozymes A/S | Polypeptides having mannanase activity and polynucleotides encoding same |
WO2019068713A1 (en) | 2017-10-02 | 2019-04-11 | Novozymes A/S | Polypeptides having mannanase activity and polynucleotides encoding same |
WO2019075144A1 (en) | 2017-10-12 | 2019-04-18 | The Procter & Gamble Company | Leuco colorants in combination with a second whitening agent as bluing agents in laundry care compositions |
WO2019075228A1 (en) | 2017-10-12 | 2019-04-18 | Milliken & Company | Leuco colorants and compositions |
WO2019075148A1 (en) | 2017-10-12 | 2019-04-18 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care compositions |
WO2019075146A1 (en) | 2017-10-12 | 2019-04-18 | The Procter & Gamble Company | Leuco colorants as bluing agents in laundry care composition |
WO2019076800A1 (en) | 2017-10-16 | 2019-04-25 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2019076833A1 (en) | 2017-10-16 | 2019-04-25 | Novozymes A/S | Low dusting granules |
WO2019076834A1 (en) | 2017-10-16 | 2019-04-25 | Novozymes A/S | Low dusting granules |
WO2019081515A1 (en) | 2017-10-24 | 2019-05-02 | Novozymes A/S | Compositions comprising polypeptides having mannanase activity |
WO2019084349A1 (en) | 2017-10-27 | 2019-05-02 | The Procter & Gamble Company | Detergent compositions comprising polypeptide variants |
WO2019084350A1 (en) | 2017-10-27 | 2019-05-02 | The Procter & Gamble Company | Detergent compositions comprising polypeptide variants |
WO2019081721A1 (en) | 2017-10-27 | 2019-05-02 | Novozymes A/S | Dnase variants |
WO2019081724A1 (en) | 2017-10-27 | 2019-05-02 | Novozymes A/S | Dnase variants |
DE102017125559A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANSING COMPOSITIONS CONTAINING DISPERSINE II |
DE102017125560A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANSING COMPOSITIONS CONTAINING DISPERSINE III |
WO2019086520A1 (en) | 2017-11-01 | 2019-05-09 | Henkel Ag & Co. Kgaa | Cleaning compositions containing dispersins i |
DE102017125558A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANING COMPOSITIONS CONTAINING DISPERSINE I |
WO2019086526A1 (en) | 2017-11-01 | 2019-05-09 | Henkel Ag & Co. Kgaa | Cleaning compositions containing dispersins iii |
WO2019086532A1 (en) | 2017-11-01 | 2019-05-09 | Novozymes A/S | Methods for cleaning medical devices |
WO2019086528A1 (en) | 2017-11-01 | 2019-05-09 | Novozymes A/S | Polypeptides and compositions comprising such polypeptides |
WO2019086521A1 (en) | 2017-11-01 | 2019-05-09 | Henkel Ag & Co. Kgaa | Cleaning compositions containing dispersins ii |
WO2019086530A1 (en) | 2017-11-01 | 2019-05-09 | Novozymes A/S | Polypeptides and compositions comprising such polypeptides |
WO2019089228A1 (en) | 2017-11-01 | 2019-05-09 | Milliken & Company | Leuco compounds, colorant compounds, and compositions containing the same |
EP4379029A1 (en) | 2017-11-01 | 2024-06-05 | Novozymes A/S | Polypeptides and compositions comprising such polypeptides |
WO2019105675A1 (en) | 2017-11-30 | 2019-06-06 | Unilever Plc | Detergent composition comprising protease |
WO2019110462A1 (en) | 2017-12-04 | 2019-06-13 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
WO2019125985A1 (en) | 2017-12-19 | 2019-06-27 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2019125990A1 (en) | 2017-12-19 | 2019-06-27 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2019125984A1 (en) | 2017-12-19 | 2019-06-27 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2019125986A1 (en) | 2017-12-19 | 2019-06-27 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3502244A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3502227A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3502246A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
EP3502245A1 (en) | 2017-12-19 | 2019-06-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2019147533A1 (en) | 2018-01-26 | 2019-08-01 | The Procter & Gamble Company | Water-soluble unit dose articles comprising enzyme |
WO2019154955A1 (en) | 2018-02-08 | 2019-08-15 | Novozymes A/S | Lipase variants and compositions thereof |
WO2019154951A1 (en) | 2018-02-08 | 2019-08-15 | Novozymes A/S | Lipases, lipase variants and compositions thereof |
WO2019154952A1 (en) | 2018-02-08 | 2019-08-15 | Novozymes A/S | Lipase variants and compositions thereof |
WO2019154954A1 (en) | 2018-02-08 | 2019-08-15 | Novozymes A/S | Lipase variants and compositions thereof |
WO2019168649A1 (en) | 2018-02-28 | 2019-09-06 | The Procter & Gamble Company | Cleaning compositions |
WO2019168650A1 (en) | 2018-02-28 | 2019-09-06 | The Procter & Gamble Company | Methods of cleaning |
WO2019201793A1 (en) | 2018-04-17 | 2019-10-24 | Novozymes A/S | Polypeptides comprising carbohydrate binding activity in detergent compositions and their use in reducing wrinkles in textile or fabric. |
WO2019201785A1 (en) | 2018-04-19 | 2019-10-24 | Novozymes A/S | Stabilized cellulase variants |
WO2019201783A1 (en) | 2018-04-19 | 2019-10-24 | Novozymes A/S | Stabilized cellulase variants |
WO2019219531A1 (en) | 2018-05-17 | 2019-11-21 | Unilever Plc | Cleaning composition |
WO2019245839A1 (en) | 2018-06-19 | 2019-12-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2019245838A1 (en) | 2018-06-19 | 2019-12-26 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2020002604A1 (en) | 2018-06-28 | 2020-01-02 | Novozymes A/S | Detergent compositions and uses thereof |
WO2020002608A1 (en) | 2018-06-29 | 2020-01-02 | Novozymes A/S | Detergent compositions and uses thereof |
WO2020007863A1 (en) | 2018-07-02 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020007875A1 (en) | 2018-07-03 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020008043A1 (en) | 2018-07-06 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020008024A1 (en) | 2018-07-06 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
WO2020023188A1 (en) | 2018-07-27 | 2020-01-30 | The Procter & Gamble Company | Water-soluble unit dose articles comprising water-soluble fibrous structures and protease |
WO2020058024A1 (en) | 2018-09-17 | 2020-03-26 | Unilever Plc | Detergent composition |
WO2020070063A2 (en) | 2018-10-01 | 2020-04-09 | Novozymes A/S | Detergent compositions and uses thereof |
WO2020070011A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition |
WO2020070014A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition comprising anionic surfactant and a polypeptide having rnase activity |
WO2020070209A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition |
WO2020070249A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Cleaning compositions |
WO2020070199A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Polypeptides having alpha-mannan degrading activity and polynucleotides encoding same |
WO2020074545A1 (en) | 2018-10-11 | 2020-04-16 | Novozymes A/S | Cleaning compositions and uses thereof |
EP3647397A1 (en) | 2018-10-31 | 2020-05-06 | Henkel AG & Co. KGaA | Cleaning compositions containing dispersins iv |
EP3647398A1 (en) | 2018-10-31 | 2020-05-06 | Henkel AG & Co. KGaA | Cleaning compositions containing dispersins v |
WO2020088957A1 (en) | 2018-10-31 | 2020-05-07 | Henkel Ag & Co. Kgaa | Cleaning compositions containing dispersins iv |
WO2020088958A1 (en) | 2018-10-31 | 2020-05-07 | Henkel Ag & Co. Kgaa | Cleaning compositions containing dispersins v |
WO2020104156A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104159A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104158A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104157A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020104155A1 (en) | 2018-11-20 | 2020-05-28 | Unilever Plc | Detergent composition |
WO2020114965A1 (en) | 2018-12-03 | 2020-06-11 | Novozymes A/S | LOW pH POWDER DETERGENT COMPOSITION |
WO2020127796A2 (en) | 2018-12-21 | 2020-06-25 | Novozymes A/S | Polypeptides having peptidoglycan degrading activity and polynucleotides encoding same |
WO2020127775A1 (en) | 2018-12-21 | 2020-06-25 | Novozymes A/S | Detergent pouch comprising metalloproteases |
WO2020186052A1 (en) | 2019-03-14 | 2020-09-17 | The Procter & Gamble Company | Method for treating cotton |
WO2020186030A1 (en) | 2019-03-14 | 2020-09-17 | The Procter & Gamble Company | Cleaning compositions comprising enzymes |
WO2020186028A1 (en) | 2019-03-14 | 2020-09-17 | The Procter & Gamble Company | Cleaning compositions comprising enzymes |
WO2020188095A1 (en) | 2019-03-21 | 2020-09-24 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
WO2020201403A1 (en) | 2019-04-03 | 2020-10-08 | Novozymes A/S | Polypeptides having beta-glucanase activity, polynucleotides encoding same and uses thereof in cleaning and detergent compositions |
WO2020207944A1 (en) | 2019-04-10 | 2020-10-15 | Novozymes A/S | Polypeptide variants |
WO2020208056A1 (en) | 2019-04-12 | 2020-10-15 | Novozymes A/S | Stabilized glycoside hydrolase variants |
WO2020229535A1 (en) | 2019-05-16 | 2020-11-19 | Unilever Plc | Laundry composition |
EP3741283A1 (en) | 2019-05-22 | 2020-11-25 | The Procter & Gamble Company | Automatic dishwashing method |
WO2020237253A1 (en) | 2019-05-22 | 2020-11-26 | The Procter & Gamble Company | Automatic dishwashing method |
WO2020243738A1 (en) | 2019-05-24 | 2020-12-03 | The Procter & Gamble Company | Automatic dishwashing detergent composition |
WO2020264552A1 (en) | 2019-06-24 | 2020-12-30 | The Procter & Gamble Company | Cleaning compositions comprising amylase variants |
WO2020260038A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020259947A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020260006A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent compositions |
WO2020259949A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020260040A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2020259948A1 (en) | 2019-06-28 | 2020-12-30 | Unilever Plc | Detergent composition |
WO2021001400A1 (en) | 2019-07-02 | 2021-01-07 | Novozymes A/S | Lipase variants and compositions thereof |
WO2021009067A1 (en) | 2019-07-12 | 2021-01-21 | Novozymes A/S | Enzymatic emulsions for detergents |
WO2021037895A1 (en) | 2019-08-27 | 2021-03-04 | Novozymes A/S | Detergent composition |
WO2021037878A1 (en) | 2019-08-27 | 2021-03-04 | Novozymes A/S | Composition comprising a lipase |
WO2021043764A1 (en) | 2019-09-02 | 2021-03-11 | Unilever Global Ip Limited | Detergent composition |
WO2021053127A1 (en) | 2019-09-19 | 2021-03-25 | Novozymes A/S | Detergent composition |
WO2021053122A1 (en) | 2019-09-19 | 2021-03-25 | Unilever Ip Holdings B.V. | Detergent compositions |
DE112020004477T5 (en) | 2019-09-19 | 2022-06-30 | Unilever Global Ip Limited | DETERGENT COMPOSITIONS |
WO2021064068A1 (en) | 2019-10-03 | 2021-04-08 | Novozymes A/S | Polypeptides comprising at least two carbohydrate binding domains |
WO2021069516A1 (en) | 2019-10-07 | 2021-04-15 | Unilever Ip Holdings B.V. | Detergent composition |
WO2021081547A2 (en) | 2019-10-24 | 2021-04-29 | The Procter & Gamble Company | Automatic dishwashing detergent composition comprising a protease |
WO2021081548A1 (en) | 2019-10-24 | 2021-04-29 | The Procter & Gamble Company | Automatic dishwashing detergent composition comprising an amylase |
WO2021118814A1 (en) | 2019-12-09 | 2021-06-17 | The Procter & Gamble Company | A detergent composition comprising a polymer |
EP3835396A1 (en) | 2019-12-09 | 2021-06-16 | The Procter & Gamble Company | A detergent composition comprising a polymer |
WO2021122117A1 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning composition coprising a dispersin and a carbohydrase |
WO2021123307A2 (en) | 2019-12-20 | 2021-06-24 | Novozymes A/S | Polypeptides having proteolytic activity and use thereof |
WO2021122118A1 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning compositions comprising dispersins vi |
WO2021122121A1 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning compositions comprising dispersins ix |
WO2021121394A1 (en) | 2019-12-20 | 2021-06-24 | Novozymes A/S | Stabilized liquid boron-free enzyme compositions |
WO2021151536A1 (en) | 2020-01-29 | 2021-08-05 | Unilever Ip Holdings B.V. | Laundry detergent product |
WO2021152120A1 (en) | 2020-01-31 | 2021-08-05 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
WO2021152123A1 (en) | 2020-01-31 | 2021-08-05 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
WO2021158429A1 (en) | 2020-02-04 | 2021-08-12 | The Procter & Gamble Company | Detergent composition |
EP3862412A1 (en) | 2020-02-04 | 2021-08-11 | The Procter & Gamble Company | Detergent composition |
EP3892708A1 (en) | 2020-04-06 | 2021-10-13 | Henkel AG & Co. KGaA | Cleaning compositions comprising dispersin variants |
WO2021204838A1 (en) | 2020-04-08 | 2021-10-14 | Novozymes A/S | Carbohydrate binding module variants |
WO2021214059A1 (en) | 2020-04-21 | 2021-10-28 | Novozymes A/S | Cleaning compositions comprising polypeptides having fructan degrading activity |
WO2021247801A1 (en) | 2020-06-05 | 2021-12-09 | The Procter & Gamble Company | Detergent compositions containing a branched surfactant |
WO2021249927A1 (en) | 2020-06-08 | 2021-12-16 | Unilever Ip Holdings B.V. | Method of improving protease activity |
WO2021259099A1 (en) | 2020-06-24 | 2021-12-30 | Novozymes A/S | Use of cellulases for removing dust mite from textile |
EP3936593A1 (en) | 2020-07-08 | 2022-01-12 | Henkel AG & Co. KGaA | Cleaning compositions and uses thereof |
WO2022008387A1 (en) | 2020-07-08 | 2022-01-13 | Henkel Ag & Co. Kgaa | Cleaning compositions and uses thereof |
WO2022023250A1 (en) | 2020-07-27 | 2022-02-03 | Unilever Ip Holdings B.V. | Use of an enzyme and surfactant for inhibiting microorganisms |
EP3950913A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method and pack |
EP3949824A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method |
EP3950911A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method |
EP3950912A1 (en) | 2020-08-04 | 2022-02-09 | The Procter & Gamble Company | Automatic dishwashing method |
WO2022031310A1 (en) | 2020-08-04 | 2022-02-10 | The Procter & Gamble Company | Automatic dishwashing method |
WO2022031312A1 (en) | 2020-08-04 | 2022-02-10 | The Procter & Gamble Company | Automatic dishwashing method and pack |
WO2022031311A1 (en) | 2020-08-04 | 2022-02-10 | The Procter & Gamble Company | Automatic dishwashing method |
WO2022031309A1 (en) | 2020-08-04 | 2022-02-10 | The Procter & Gamble Company | Automatic dishwashing method |
WO2022043321A2 (en) | 2020-08-25 | 2022-03-03 | Novozymes A/S | Variants of a family 44 xyloglucanase |
WO2022042977A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Detergent composition |
WO2022043045A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Detergent composition |
WO2022042989A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Surfactant and detergent composition |
WO2022043138A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Surfactant and detergent composition |
WO2022043042A1 (en) | 2020-08-28 | 2022-03-03 | Unilever Ip Holdings B.V. | Detergent composition |
WO2022058322A1 (en) | 2020-09-15 | 2022-03-24 | Novozymes A/S | Animal feed comprising insects or insect meal |
WO2022074037A2 (en) | 2020-10-07 | 2022-04-14 | Novozymes A/S | Alpha-amylase variants |
WO2022084303A2 (en) | 2020-10-20 | 2022-04-28 | Novozymes A/S | Use of polypeptides having dnase activity |
WO2022093189A1 (en) | 2020-10-27 | 2022-05-05 | Milliken & Company | Compositions comprising leuco compounds and colorants |
WO2022090320A1 (en) | 2020-10-28 | 2022-05-05 | Novozymes A/S | Use of lipoxygenase |
WO2022094163A1 (en) | 2020-10-29 | 2022-05-05 | The Procter & Gamble Company | Cleaning composition comprising alginate lyase enzymes |
WO2022090361A2 (en) | 2020-10-29 | 2022-05-05 | Novozymes A/S | Lipase variants and compositions comprising such lipase variants |
WO2022094164A1 (en) | 2020-10-29 | 2022-05-05 | The Procter & Gamble Company | Cleaning composition comprising alginate lyase enzymes |
WO2022094588A1 (en) | 2020-10-29 | 2022-05-05 | The Procter & Gamble Company | Cleaning compositions containing alginate lyase enzymes |
WO2022094589A1 (en) | 2020-10-29 | 2022-05-05 | The Procter & Gamble Company | Cleaning compositions containing alginase enzymes |
WO2022094590A1 (en) | 2020-10-29 | 2022-05-05 | The Procter & Gamble Company | Cleaning compositions containing alginate lyase enzymes |
WO2022103725A1 (en) | 2020-11-13 | 2022-05-19 | Novozymes A/S | Detergent composition comprising a lipase |
EP4001390A1 (en) | 2020-11-17 | 2022-05-25 | The Procter & Gamble Company | Automatic dishwashing method with alkaline rinse |
WO2022108766A1 (en) | 2020-11-17 | 2022-05-27 | The Procter & Gamble Company | Automatic dishwashing composition comprising amphiphilic graft polymer |
WO2022108765A1 (en) | 2020-11-17 | 2022-05-27 | The Procter & Gamble Company | Automatic dishwashing method with amphiphilic graft polymer in the rinse |
WO2022108611A1 (en) | 2020-11-17 | 2022-05-27 | The Procter & Gamble Company | Automatic dishwashing method with alkaline rinse |
EP4001388A1 (en) | 2020-11-17 | 2022-05-25 | The Procter & Gamble Company | Automatic dishwashing method with amphiphilic graft polymer in the rinse |
EP4001387A1 (en) | 2020-11-17 | 2022-05-25 | The Procter & Gamble Company | Automatic dishwashing composition commprising amphiphilic graft polymer |
WO2022106400A1 (en) | 2020-11-18 | 2022-05-27 | Novozymes A/S | Combination of immunochemically different proteases |
EP4006131A1 (en) | 2020-11-30 | 2022-06-01 | The Procter & Gamble Company | Method of laundering fabric |
WO2022122480A1 (en) | 2020-12-07 | 2022-06-16 | Unilever Ip Holdings B.V. | Detergent compositions |
WO2022122481A1 (en) | 2020-12-07 | 2022-06-16 | Unilever Ip Holdings B.V. | Detergent compositions |
WO2022136389A1 (en) | 2020-12-23 | 2022-06-30 | Basf Se | Amphiphilic alkoxylated polyamines and their uses |
WO2022157311A1 (en) | 2021-01-22 | 2022-07-28 | Novozymes A/S | Liquid enzyme composition with sulfite scavenger |
EP4032966A1 (en) | 2021-01-22 | 2022-07-27 | Novozymes A/S | Liquid enzyme composition with sulfite scavenger |
WO2022162043A1 (en) | 2021-01-28 | 2022-08-04 | Novozymes A/S | Lipase with low malodor generation |
WO2022171872A1 (en) | 2021-02-12 | 2022-08-18 | Novozymes A/S | Stabilized biological detergents |
WO2022171780A2 (en) | 2021-02-12 | 2022-08-18 | Novozymes A/S | Alpha-amylase variants |
WO2022189521A1 (en) | 2021-03-12 | 2022-09-15 | Novozymes A/S | Polypeptide variants |
WO2022194668A1 (en) | 2021-03-15 | 2022-09-22 | Novozymes A/S | Polypeptide variants |
WO2022197512A1 (en) | 2021-03-15 | 2022-09-22 | The Procter & Gamble Company | Cleaning compositions containing polypeptide variants |
EP4060036A1 (en) | 2021-03-15 | 2022-09-21 | Novozymes A/S | Polypeptide variants |
EP4060010A2 (en) | 2021-03-15 | 2022-09-21 | The Procter & Gamble Company | Cleaning compositions containing polypeptide variants |
WO2022194673A1 (en) | 2021-03-15 | 2022-09-22 | Novozymes A/S | Dnase variants |
WO2022199418A1 (en) | 2021-03-26 | 2022-09-29 | Novozymes A/S | Detergent composition with reduced polymer content |
EP4095223A1 (en) | 2021-05-05 | 2022-11-30 | The Procter & Gamble Company | Methods for making cleaning compositions and for detecting soils |
WO2022235720A1 (en) | 2021-05-05 | 2022-11-10 | The Procter & Gamble Company | Methods for making cleaning compositions and detecting soils |
WO2022236297A1 (en) | 2021-05-06 | 2022-11-10 | The Procter & Gamble Company | Surface treatment |
EP4086330A1 (en) | 2021-05-06 | 2022-11-09 | The Procter & Gamble Company | Surface treatment |
WO2022272255A1 (en) | 2021-06-22 | 2022-12-29 | The Procter & Gamble Company | Cleaning or treatment compositions containing nuclease enzymes |
EP4108767A1 (en) | 2021-06-22 | 2022-12-28 | The Procter & Gamble Company | Cleaning or treatment compositions containing nuclease enzymes |
WO2022268885A1 (en) | 2021-06-23 | 2022-12-29 | Novozymes A/S | Alpha-amylase polypeptides |
WO2023003633A1 (en) | 2021-07-19 | 2023-01-26 | The Procter & Gamble Company | Fabric treatment using bacterial spores |
WO2023004215A1 (en) | 2021-07-19 | 2023-01-26 | The Procter & Gamble Company | Composition comprising spores and pro-perfume materials |
EP4123007A1 (en) | 2021-07-19 | 2023-01-25 | The Procter & Gamble Company | Fabric treatment using bacterial spores |
EP4123006A1 (en) | 2021-07-19 | 2023-01-25 | The Procter & Gamble Company | Composition comprising spores and pro-perfume materials |
WO2023017794A1 (en) | 2021-08-10 | 2023-02-16 | 株式会社日本触媒 | Polyalkylene-oxide-containing compound |
WO2023041694A1 (en) | 2021-09-20 | 2023-03-23 | Unilever Ip Holdings B.V. | Detergent composition |
WO2023064749A1 (en) | 2021-10-14 | 2023-04-20 | The Procter & Gamble Company | A fabric and home care product comprising cationic soil release polymer and lipase enzyme |
WO2023107803A1 (en) | 2021-12-08 | 2023-06-15 | The Procter & Gamble Company | Laundry treatment cartridge |
WO2023107804A1 (en) | 2021-12-08 | 2023-06-15 | The Procter & Gamble Company | Laundry treatment cartridge |
EP4194536A1 (en) | 2021-12-08 | 2023-06-14 | The Procter & Gamble Company | Laundry treatment cartridge |
EP4194537A1 (en) | 2021-12-08 | 2023-06-14 | The Procter & Gamble Company | Laundry treatment cartridge |
WO2023114794A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Fabric and home care composition comprising a protease |
WO2023114793A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Home care composition |
WO2023114795A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Automatic dishwashing composition comprising a protease |
WO2023114792A1 (en) | 2021-12-16 | 2023-06-22 | The Procter & Gamble Company | Home care composition comprising an amylase |
WO2023116569A1 (en) | 2021-12-21 | 2023-06-29 | Novozymes A/S | Composition comprising a lipase and a booster |
WO2023126254A1 (en) | 2021-12-30 | 2023-07-06 | Novozymes A/S | Protein particles with improved whiteness |
EP4206309A1 (en) | 2021-12-30 | 2023-07-05 | Novozymes A/S | Protein particles with improved whiteness |
EP4234664A1 (en) | 2022-02-24 | 2023-08-30 | Evonik Operations GmbH | Composition comprising glucolipids and enzymes |
WO2023165507A1 (en) | 2022-03-02 | 2023-09-07 | Novozymes A/S | Use of xyloglucanase for improvement of sustainability of detergents |
WO2023165950A1 (en) | 2022-03-04 | 2023-09-07 | Novozymes A/S | Dnase variants and compositions |
WO2023194204A1 (en) | 2022-04-08 | 2023-10-12 | Novozymes A/S | Hexosaminidase variants and compositions |
EP4273209A1 (en) | 2022-05-04 | 2023-11-08 | The Procter & Gamble Company | Machine-cleaning compositions containing enzymes |
WO2023215680A1 (en) | 2022-05-04 | 2023-11-09 | The Procter & Gamble Company | Machine-cleaning compositions containing enzymes |
WO2023215679A1 (en) | 2022-05-04 | 2023-11-09 | The Procter & Gamble Company | Detergent compositions containing enzymes |
EP4273210A1 (en) | 2022-05-04 | 2023-11-08 | The Procter & Gamble Company | Detergent compositions containing enzymes |
WO2023224754A1 (en) | 2022-05-19 | 2023-11-23 | The Procter & Gamble Company | Laundry composition comprising spores |
EP4279571A1 (en) | 2022-05-19 | 2023-11-22 | The Procter & Gamble Company | Laundry composition comprising spores |
WO2023227421A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Laundry liquid composition comprising a surfactant, an alkoxylated zwitterionic polyamine polymer, and a fragrance |
WO2023227331A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Composition comprising a specific methyl ester ethoxylate surfactant and a lipase |
WO2023227332A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Laundry liquid composition comprising a surfactant, an alkoxylated zwitterionic polyamine polymer and a protease |
WO2023227335A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Liquid composition comprising linear alkyl benzene sulphonate, methyl ester ethoxylate and alkoxylated zwitterionic polyamine polymer |
WO2023227375A1 (en) | 2022-05-27 | 2023-11-30 | Unilever Ip Holdings B.V. | Laundry liquid composition comprising a surfactant, an aminocarboxylate, an organic acid and a fragrance |
WO2023233028A1 (en) | 2022-06-03 | 2023-12-07 | Unilever Ip Holdings B.V. | Laundry detergent product |
WO2023247348A1 (en) | 2022-06-21 | 2023-12-28 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
WO2023247664A2 (en) | 2022-06-24 | 2023-12-28 | Novozymes A/S | Lipase variants and compositions comprising such lipase variants |
WO2024036126A1 (en) | 2022-08-08 | 2024-02-15 | The Procter & Gamble Company | A fabric and home care composition comprising surfactant and a polyester |
EP4321604A1 (en) | 2022-08-08 | 2024-02-14 | The Procter & Gamble Company | A fabric and home care composition comprising surfactant and a polyester |
WO2024056334A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
WO2024056333A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
WO2024056278A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
WO2024056331A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
WO2024056332A1 (en) | 2022-09-13 | 2024-03-21 | Unilever Ip Holdings B.V. | Washing machine and washing method |
EP4349948A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349947A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349943A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349942A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349945A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349944A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Laundry liquid composition |
EP4349946A1 (en) | 2022-10-05 | 2024-04-10 | Unilever IP Holdings B.V. | Unit dose fabric treatment product |
EP4361239A1 (en) | 2022-10-25 | 2024-05-01 | Unilever IP Holdings B.V. | Laundry liquid composition |
WO2024088716A1 (en) | 2022-10-25 | 2024-05-02 | Unilever Ip Holdings B.V. | Composition |
WO2024088706A1 (en) | 2022-10-25 | 2024-05-02 | Unilever Ip Holdings B.V. | Composition |
WO2024094800A1 (en) | 2022-11-04 | 2024-05-10 | The Procter & Gamble Company | Fabric and home care composition |
WO2024094803A1 (en) | 2022-11-04 | 2024-05-10 | The Procter & Gamble Company | Fabric and home care composition |
WO2024094802A1 (en) | 2022-11-04 | 2024-05-10 | The Procter & Gamble Company | Fabric and home care composition |
WO2024115106A1 (en) | 2022-11-29 | 2024-06-06 | Unilever Ip Holdings B.V. | Composition |
WO2024119298A1 (en) | 2022-12-05 | 2024-06-13 | The Procter & Gamble Company | Fabric and home care composition comprising a polyalkylenecarbonate compound |
WO2024121058A1 (en) | 2022-12-05 | 2024-06-13 | Novozymes A/S | A composition comprising a lipase and a peptide |
WO2024129520A1 (en) | 2022-12-12 | 2024-06-20 | The Procter & Gamble Company | Fabric and home care composition |
WO2024126483A1 (en) | 2022-12-14 | 2024-06-20 | Novozymes A/S | Improved lipase (gcl1) variants |
EP4386074A1 (en) | 2022-12-16 | 2024-06-19 | The Procter & Gamble Company | Fabric and home care composition |
EP4388967A1 (en) | 2022-12-19 | 2024-06-26 | The Procter & Gamble Company | Dishwashing method |
WO2024132625A1 (en) | 2022-12-20 | 2024-06-27 | Basf Se | Cutinases |
EP4389864A1 (en) | 2022-12-20 | 2024-06-26 | Basf Se | Cutinases |
WO2024133344A1 (en) | 2022-12-20 | 2024-06-27 | Novozymes A/S | A method for providing a candidate biological sequence and related electronic device |
WO2024131880A2 (en) | 2022-12-23 | 2024-06-27 | Novozymes A/S | Detergent composition comprising catalase and amylase |
WO2024156628A1 (en) | 2023-01-23 | 2024-08-02 | Novozymes A/S | Cleaning compositions and uses thereof |
EP4410941A1 (en) | 2023-02-01 | 2024-08-07 | The Procter & Gamble Company | Detergent compositions containing enzymes |
WO2024163695A1 (en) | 2023-02-01 | 2024-08-08 | The Procter & Gamble Company | Detergent compositions containing enzymes |
WO2024194190A1 (en) | 2023-03-17 | 2024-09-26 | Unilever Ip Holdings B.V. | Composition |
WO2024194245A1 (en) | 2023-03-21 | 2024-09-26 | Novozymes A/S | Detergent compositions based on biosurfactants |
WO2024194098A1 (en) | 2023-03-21 | 2024-09-26 | Unilever Ip Holdings B.V. | Detergent unit dose |
WO2024213430A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213428A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213376A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213443A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213438A1 (en) | 2023-04-11 | 2024-10-17 | Unilever Ip Holdings B.V. | Composition |
WO2024213513A1 (en) | 2023-04-12 | 2024-10-17 | Novozymes A/S | Compositions comprising polypeptides having alkaline phosphatase activity |
WO2024223218A1 (en) | 2023-04-25 | 2024-10-31 | Unilever Ip Holdings B.V. | Composition |
WO2024226828A2 (en) | 2023-04-26 | 2024-10-31 | Novozymes A/S | Cleaning composition and cleaning method |
EP4458932A1 (en) | 2023-05-04 | 2024-11-06 | The Procter & Gamble Company | A fabric and home care composition |
EP4458933A1 (en) | 2023-05-05 | 2024-11-06 | The Procter & Gamble Company | A fabric and home care composition comprising a propoxylated polyol |
WO2024233240A1 (en) | 2023-05-05 | 2024-11-14 | The Procter & Gamble Company | A fabric and home care composition comprising a propoxylated polyol |
EP4461796A1 (en) | 2023-05-10 | 2024-11-13 | Novozymes A/S | Detergent composition comprising laccase |
EP4461795A1 (en) | 2023-05-10 | 2024-11-13 | Novozymes A/S | Detergent composition comprising laccase |
WO2024231483A1 (en) | 2023-05-11 | 2024-11-14 | Novozymes A/S | Automatic dishwashing detergent compositions comprising a lipase |
EP4481027A1 (en) | 2023-06-19 | 2024-12-25 | The Procter & Gamble Company | Cleaning compositions containing enzymes |
WO2024263486A2 (en) | 2023-06-19 | 2024-12-26 | The Procter & Gamble Company | Cleaning compositions containing enzymes |
EP4484536A1 (en) | 2023-06-26 | 2025-01-01 | The Procter & Gamble Company | Fabric and home care composition |
WO2025006207A1 (en) | 2023-06-26 | 2025-01-02 | The Procter & Gamble Company | Fabric and home care composition |
WO2025002934A1 (en) | 2023-06-28 | 2025-01-02 | Novozymes A/S | Detergent composition comprising lipases |
WO2025010322A1 (en) | 2023-07-03 | 2025-01-09 | The Procter & Gamble Company | Compositions containing a porphyrin binding protein |
EP4488351A1 (en) | 2023-07-03 | 2025-01-08 | The Procter & Gamble Company | Compositions containing a porphyrin binding protein |
WO2025011933A1 (en) | 2023-07-07 | 2025-01-16 | Novozymes A/S | Washing method for removing proteinaceous stains |
WO2025011808A1 (en) | 2023-07-11 | 2025-01-16 | Unilever Ip Holdings B.V. | Method for treating fabric |
WO2025011886A1 (en) | 2023-07-11 | 2025-01-16 | Unilever Ip Holdings B.V. | Method for treating fabric |
WO2025012293A1 (en) | 2023-07-13 | 2025-01-16 | Unilever Ip Holdings B.V. | Washing machine and method |
WO2025016669A1 (en) | 2023-07-19 | 2025-01-23 | Unilever Ip Holdings B.V. | Laundry capsule |
WO2025026734A1 (en) | 2023-08-02 | 2025-02-06 | Unilever Ip Holdings B.V. | Composition |
EP4509589A1 (en) | 2023-08-16 | 2025-02-19 | Unilever IP Holdings B.V. | Unit dose product |
US12227785B2 (en) | 2023-10-23 | 2025-02-18 | Novozymes A/S | Compositions comprising a low pH alpha-amylase and a thermostable protease for liquefaction |
Also Published As
Publication number | Publication date |
---|---|
CN103421760A (en) | 2013-12-04 |
JP5244317B2 (en) | 2013-07-24 |
EP1694847A2 (en) | 2006-08-30 |
KR20130083461A (en) | 2013-07-22 |
KR101482015B1 (en) | 2015-01-23 |
WO2005052146A8 (en) | 2006-08-24 |
AU2004293826B2 (en) | 2009-09-17 |
WO2005052146A3 (en) | 2005-11-10 |
WO2005052161A3 (en) | 2005-11-03 |
AU2009250976B2 (en) | 2013-01-31 |
AU2004293826A1 (en) | 2005-06-09 |
US8535927B1 (en) | 2013-09-17 |
DK1694847T3 (en) | 2012-09-03 |
AU2009250976A1 (en) | 2010-01-14 |
CN1906303A (en) | 2007-01-31 |
CA2546451A1 (en) | 2005-06-09 |
CN1906303B (en) | 2013-06-05 |
WO2005052161A2 (en) | 2005-06-09 |
EP1694847B1 (en) | 2012-06-13 |
BRPI0416797A (en) | 2007-04-17 |
KR20060121212A (en) | 2006-11-28 |
JP2007515164A (en) | 2007-06-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2004293826B2 (en) | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same | |
US11987825B2 (en) | Serine proteases | |
CN109477112B (en) | Protease variants and uses thereof | |
US20200291374A1 (en) | Novel metalloproteases | |
US7985569B2 (en) | Cellulomonas 69B4 serine protease variants | |
EP3310911B1 (en) | Bacillus gibsonii-clade serine proteases | |
EP3268471B1 (en) | Compositions and methods comprising lg12-clade protease variants | |
CN107835855B (en) | AprL-clade protease variants and uses thereof | |
US20190185838A1 (en) | Serine proteases of bacillus species | |
CN106029881B (en) | Serine proteases of the Bacillus gibsonii-clade | |
EP2205730B1 (en) | Streptomyces protease | |
EP4403631A2 (en) | Serine proteases | |
JP7152319B2 (en) | Protease variants and uses thereof | |
MXPA06005107A (en) | Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same | |
RU2790443C2 (en) | Protease variants and their applications |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 2004293826 Country of ref document: AU |
|
WWP | Wipo information: published in national office |
Ref document number: 2004293826 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2006/005107 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 12006500940 Country of ref document: PH |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2546451 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2006541585 Country of ref document: JP Ref document number: 2866/DELNP/2006 Country of ref document: IN |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004811731 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020067011919 Country of ref document: KR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020067012183 Country of ref document: KR Ref document number: 1200600972 Country of ref document: VN |
|
WWE | Wipo information: entry into national phase |
Ref document number: 200480040520.X Country of ref document: CN |
|
WWP | Wipo information: published in national office |
Ref document number: 2004811731 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 1020067012183 Country of ref document: KR |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 1020067011919 Country of ref document: KR |
|
ENP | Entry into the national phase |
Ref document number: PI0416797 Country of ref document: BR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 10576331 Country of ref document: US |