CA2442755A1 - Methods for modification of plant inflorescence architecture - Google Patents
Methods for modification of plant inflorescence architecture Download PDFInfo
- Publication number
- CA2442755A1 CA2442755A1 CA002442755A CA2442755A CA2442755A1 CA 2442755 A1 CA2442755 A1 CA 2442755A1 CA 002442755 A CA002442755 A CA 002442755A CA 2442755 A CA2442755 A CA 2442755A CA 2442755 A1 CA2442755 A1 CA 2442755A1
- Authority
- CA
- Canada
- Prior art keywords
- plant
- nucleotide sequence
- seq
- gene
- inflorescence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 93
- 238000012986 modification Methods 0.000 title description 5
- 230000004048 modification Effects 0.000 title description 5
- 241000196324 Embryophyta Species 0.000 claims abstract description 285
- 108091028043 Nucleic acid sequence Proteins 0.000 claims abstract description 59
- 241000219194 Arabidopsis Species 0.000 claims abstract description 34
- 230000009261 transgenic effect Effects 0.000 claims abstract description 33
- 108020004414 DNA Proteins 0.000 claims description 99
- 230000014509 gene expression Effects 0.000 claims description 74
- 239000002773 nucleotide Substances 0.000 claims description 73
- 125000003729 nucleotide group Chemical group 0.000 claims description 73
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 40
- 230000009466 transformation Effects 0.000 claims description 35
- 230000035772 mutation Effects 0.000 claims description 34
- 230000000295 complement effect Effects 0.000 claims description 26
- 230000001105 regulatory effect Effects 0.000 claims description 21
- 230000002103 transcriptional effect Effects 0.000 claims description 16
- 241000219198 Brassica Species 0.000 claims description 15
- 101150038737 KNAT1 gene Proteins 0.000 claims description 15
- 230000000692 anti-sense effect Effects 0.000 claims description 15
- 235000011331 Brassica Nutrition 0.000 claims description 12
- 230000005764 inhibitory process Effects 0.000 claims description 10
- 238000011084 recovery Methods 0.000 claims description 8
- 241000219193 Brassicaceae Species 0.000 claims description 6
- 230000001747 exhibiting effect Effects 0.000 claims description 6
- 241000209510 Liliopsida Species 0.000 claims description 4
- 241001233957 eudicotyledons Species 0.000 claims description 4
- 210000000056 organ Anatomy 0.000 claims description 4
- 101100288144 Arabidopsis thaliana KNAT1 gene Proteins 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 3
- 230000003247 decreasing effect Effects 0.000 claims description 2
- 230000001172 regenerating effect Effects 0.000 claims description 2
- 108700001784 Arabidopsis KNAT1 Proteins 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 abstract description 272
- 108091033319 polynucleotide Proteins 0.000 abstract description 25
- 102000040430 polynucleotide Human genes 0.000 abstract description 25
- 239000002157 polynucleotide Substances 0.000 abstract description 25
- 230000006870 function Effects 0.000 abstract description 22
- 241000218922 Magnoliophyta Species 0.000 abstract description 19
- 230000004075 alteration Effects 0.000 abstract description 18
- 230000018109 developmental process Effects 0.000 abstract description 16
- 238000011161 development Methods 0.000 abstract description 15
- 102000004169 proteins and genes Human genes 0.000 description 88
- 235000018102 proteins Nutrition 0.000 description 86
- 210000004027 cell Anatomy 0.000 description 62
- 150000007523 nucleic acids Chemical group 0.000 description 52
- 239000013598 vector Substances 0.000 description 44
- 108091026890 Coding region Proteins 0.000 description 35
- 239000002299 complementary DNA Substances 0.000 description 35
- 108700026244 Open Reading Frames Proteins 0.000 description 27
- 150000001413 amino acids Chemical class 0.000 description 26
- 102000039446 nucleic acids Human genes 0.000 description 23
- 108020004707 nucleic acids Proteins 0.000 description 23
- 241000894007 species Species 0.000 description 22
- 240000002791 Brassica napus Species 0.000 description 19
- 229940024606 amino acid Drugs 0.000 description 19
- 235000001014 amino acid Nutrition 0.000 description 19
- 108700005087 Homeobox Genes Proteins 0.000 description 16
- 239000000523 sample Substances 0.000 description 16
- 210000000349 chromosome Anatomy 0.000 description 15
- 230000002068 genetic effect Effects 0.000 description 15
- 238000009396 hybridization Methods 0.000 description 15
- 230000000694 effects Effects 0.000 description 14
- 230000009467 reduction Effects 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 12
- 102000004196 processed proteins & peptides Human genes 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- 210000001339 epidermal cell Anatomy 0.000 description 11
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 10
- 240000007124 Brassica oleracea Species 0.000 description 10
- 102000009331 Homeodomain Proteins Human genes 0.000 description 10
- 108010048671 Homeodomain Proteins Proteins 0.000 description 10
- 108020004511 Recombinant DNA Proteins 0.000 description 10
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 10
- 230000024245 cell differentiation Effects 0.000 description 10
- 238000002955 isolation Methods 0.000 description 10
- 230000004069 differentiation Effects 0.000 description 9
- 238000004626 scanning electron microscopy Methods 0.000 description 9
- 240000000385 Brassica napus var. napus Species 0.000 description 8
- 108020004705 Codon Proteins 0.000 description 8
- 230000032823 cell division Effects 0.000 description 8
- 238000003757 reverse transcription PCR Methods 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 108020005544 Antisense RNA Proteins 0.000 description 7
- 235000014698 Brassica juncea var multisecta Nutrition 0.000 description 7
- 235000006008 Brassica napus var napus Nutrition 0.000 description 7
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 7
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 7
- 238000007792 addition Methods 0.000 description 7
- 239000003184 complementary RNA Substances 0.000 description 7
- 238000012217 deletion Methods 0.000 description 7
- 230000037430 deletion Effects 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 238000010276 construction Methods 0.000 description 6
- 230000001054 cortical effect Effects 0.000 description 6
- 239000003550 marker Substances 0.000 description 6
- 108020004999 messenger RNA Proteins 0.000 description 6
- 238000011144 upstream manufacturing Methods 0.000 description 6
- 108700028369 Alleles Proteins 0.000 description 5
- ACRYGQFHAQHDSF-ZLUOBGJFSA-N Asn-Asn-Asn Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ACRYGQFHAQHDSF-ZLUOBGJFSA-N 0.000 description 5
- 235000011293 Brassica napus Nutrition 0.000 description 5
- 241000701489 Cauliflower mosaic virus Species 0.000 description 5
- 108020004635 Complementary DNA Proteins 0.000 description 5
- 108091092195 Intron Proteins 0.000 description 5
- 238000002105 Southern blotting Methods 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 230000012010 growth Effects 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 230000002018 overexpression Effects 0.000 description 5
- 230000008121 plant development Effects 0.000 description 5
- 230000017260 vegetative to reproductive phase transition of meristem Effects 0.000 description 5
- 230000008901 benefit Effects 0.000 description 4
- 210000002230 centromere Anatomy 0.000 description 4
- 230000001276 controlling effect Effects 0.000 description 4
- 230000007547 defect Effects 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 102000054765 polymorphisms of proteins Human genes 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 241001149092 Arabidopsis sp. Species 0.000 description 3
- 101100288145 Arabidopsis thaliana KNAT2 gene Proteins 0.000 description 3
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 3
- 230000003466 anti-cipated effect Effects 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 244000038559 crop plants Species 0.000 description 3
- 230000008124 floral development Effects 0.000 description 3
- 238000003306 harvesting Methods 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 230000000243 photosynthetic effect Effects 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 238000010839 reverse transcription Methods 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 230000007704 transition Effects 0.000 description 3
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- PUAQLLVFLMYYJJ-UHFFFAOYSA-N 2-aminopropiophenone Chemical compound CC(N)C(=O)C1=CC=CC=C1 PUAQLLVFLMYYJJ-UHFFFAOYSA-N 0.000 description 2
- 240000008100 Brassica rapa Species 0.000 description 2
- 101000583086 Bunodosoma granuliferum Delta-actitoxin-Bgr2b Proteins 0.000 description 2
- 230000004568 DNA-binding Effects 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 2
- 108091005682 Receptor kinases Proteins 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000005452 bending Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 239000006227 byproduct Substances 0.000 description 2
- 238000010804 cDNA synthesis Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 210000001723 extracellular space Anatomy 0.000 description 2
- 101150073818 gap gene Proteins 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 238000012252 genetic analysis Methods 0.000 description 2
- 108010049041 glutamylalanine Proteins 0.000 description 2
- 230000002363 herbicidal effect Effects 0.000 description 2
- 239000004009 herbicide Substances 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 235000009973 maize Nutrition 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 208000024191 minimally invasive lung adenocarcinoma Diseases 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 230000004853 protein function Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- COEXAQSTZUWMRI-STQMWFEESA-N (2s)-1-[2-[[(2s)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]pyrrolidine-2-carboxylic acid Chemical compound C([C@H](N)C(=O)NCC(=O)N1[C@@H](CCC1)C(O)=O)C1=CC=C(O)C=C1 COEXAQSTZUWMRI-STQMWFEESA-N 0.000 description 1
- 101150084750 1 gene Proteins 0.000 description 1
- 108020005345 3' Untranslated Regions Proteins 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 101150096316 5 gene Proteins 0.000 description 1
- 241000299862 Actinote thalia Species 0.000 description 1
- LBJYAILUMSUTAM-ZLUOBGJFSA-N Ala-Asn-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O LBJYAILUMSUTAM-ZLUOBGJFSA-N 0.000 description 1
- OLVCTPPSXNRGKV-GUBZILKMSA-N Ala-Pro-Pro Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 OLVCTPPSXNRGKV-GUBZILKMSA-N 0.000 description 1
- NCQMBSJGJMYKCK-ZLUOBGJFSA-N Ala-Ser-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O NCQMBSJGJMYKCK-ZLUOBGJFSA-N 0.000 description 1
- ZJLORAAXDAJLDC-CQDKDKBSSA-N Ala-Tyr-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O ZJLORAAXDAJLDC-CQDKDKBSSA-N 0.000 description 1
- 241000219195 Arabidopsis thaliana Species 0.000 description 1
- 101100288149 Arabidopsis thaliana KNAT6 gene Proteins 0.000 description 1
- PTVGLOCPAVYPFG-CIUDSAMLSA-N Arg-Gln-Asp Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O PTVGLOCPAVYPFG-CIUDSAMLSA-N 0.000 description 1
- PIWWUBYJNONVTJ-ZLUOBGJFSA-N Asn-Asp-Asn Chemical compound C([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)C(=O)N PIWWUBYJNONVTJ-ZLUOBGJFSA-N 0.000 description 1
- WQLJRNRLHWJIRW-KKUMJFAQSA-N Asn-His-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CC2=CN=CN2)NC(=O)[C@H](CC(=O)N)N)O WQLJRNRLHWJIRW-KKUMJFAQSA-N 0.000 description 1
- QYRMBFWDSFGSFC-OLHMAJIHSA-N Asn-Thr-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O QYRMBFWDSFGSFC-OLHMAJIHSA-N 0.000 description 1
- HMQDRBKQMLRCCG-GMOBBJLQSA-N Asp-Arg-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HMQDRBKQMLRCCG-GMOBBJLQSA-N 0.000 description 1
- KNMRXHIAVXHCLW-ZLUOBGJFSA-N Asp-Asn-Ser Chemical compound C([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N)C(=O)O KNMRXHIAVXHCLW-ZLUOBGJFSA-N 0.000 description 1
- RDRMWJBLOSRRAW-BYULHYEWSA-N Asp-Asn-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O RDRMWJBLOSRRAW-BYULHYEWSA-N 0.000 description 1
- APYNREQHZOGYHV-ACZMJKKPSA-N Asp-Cys-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)N APYNREQHZOGYHV-ACZMJKKPSA-N 0.000 description 1
- CSEJMKNZDCJYGJ-XHNCKOQMSA-N Asp-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)O)N)C(=O)O CSEJMKNZDCJYGJ-XHNCKOQMSA-N 0.000 description 1
- ZUNMTUPRQMWMHX-LSJOCFKGSA-N Asp-Val-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O ZUNMTUPRQMWMHX-LSJOCFKGSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 229930192334 Auxin Natural products 0.000 description 1
- 235000011303 Brassica alboglabra Nutrition 0.000 description 1
- 235000011302 Brassica oleracea Nutrition 0.000 description 1
- 235000003899 Brassica oleracea var acephala Nutrition 0.000 description 1
- 235000012905 Brassica oleracea var viridis Nutrition 0.000 description 1
- 108091027551 Cointegrate Proteins 0.000 description 1
- UDDITVWSXPEAIQ-IHRRRGAJSA-N Cys-Phe-Arg Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UDDITVWSXPEAIQ-IHRRRGAJSA-N 0.000 description 1
- 101150066284 DET2 gene Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 208000034454 F12-related hereditary angioedema with normal C1Inh Diseases 0.000 description 1
- 229930191978 Gibberellin Natural products 0.000 description 1
- LJEPDHWNQXPXMM-NHCYSSNCSA-N Gln-Arg-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O LJEPDHWNQXPXMM-NHCYSSNCSA-N 0.000 description 1
- GLAPJAHOPFSLKL-SRVKXCTJSA-N Gln-His-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCC(=O)N)N GLAPJAHOPFSLKL-SRVKXCTJSA-N 0.000 description 1
- HUWSBFYAGXCXKC-CIUDSAMLSA-N Glu-Ala-Met Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(O)=O HUWSBFYAGXCXKC-CIUDSAMLSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- YJDALMUYJIENAG-QWRGUYRKSA-N Gly-Tyr-Asn Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)CN)O YJDALMUYJIENAG-QWRGUYRKSA-N 0.000 description 1
- STOOMQFEJUVAKR-KKUMJFAQSA-N His-His-His Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC=1N=CNC=1)C(O)=O)C1=CNC=N1 STOOMQFEJUVAKR-KKUMJFAQSA-N 0.000 description 1
- FJCGVRRVBKYYOU-DCAQKATOSA-N His-Met-Ser Chemical compound CSCC[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC1=CN=CN1)N FJCGVRRVBKYYOU-DCAQKATOSA-N 0.000 description 1
- XIGFLVCAVQQGNS-IHRRRGAJSA-N His-Pro-His Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 XIGFLVCAVQQGNS-IHRRRGAJSA-N 0.000 description 1
- 101000884385 Homo sapiens Arylamine N-acetyltransferase 1 Proteins 0.000 description 1
- 101001034811 Homo sapiens Eukaryotic translation initiation factor 4 gamma 2 Proteins 0.000 description 1
- 101000639975 Homo sapiens Sodium-dependent noradrenaline transporter Proteins 0.000 description 1
- ZXIGYKICRDFISM-DJFWLOJKSA-N Ile-His-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC(=O)N)C(=O)O)N ZXIGYKICRDFISM-DJFWLOJKSA-N 0.000 description 1
- WIZPFZKOFZXDQG-HTFCKZLJSA-N Ile-Ile-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O WIZPFZKOFZXDQG-HTFCKZLJSA-N 0.000 description 1
- PXKACEXYLPBMAD-JBDRJPRFSA-N Ile-Ser-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PXKACEXYLPBMAD-JBDRJPRFSA-N 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 1
- SITWEMZOJNKJCH-UHFFFAOYSA-N L-alanine-L-arginine Natural products CC(N)C(=O)NC(C(O)=O)CCCNC(N)=N SITWEMZOJNKJCH-UHFFFAOYSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- JNDYEOUZBLOVOF-AVGNSLFASA-N Leu-Leu-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O JNDYEOUZBLOVOF-AVGNSLFASA-N 0.000 description 1
- XVZCXCTYGHPNEM-UHFFFAOYSA-N Leu-Leu-Pro Natural products CC(C)CC(N)C(=O)NC(CC(C)C)C(=O)N1CCCC1C(O)=O XVZCXCTYGHPNEM-UHFFFAOYSA-N 0.000 description 1
- UHNQRAFSEBGZFZ-YESZJQIVSA-N Leu-Phe-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N2CCC[C@@H]2C(=O)O)N UHNQRAFSEBGZFZ-YESZJQIVSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- WSXTWLJHTLRFLW-SRVKXCTJSA-N Lys-Ala-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O WSXTWLJHTLRFLW-SRVKXCTJSA-N 0.000 description 1
- 108010062166 Lys-Asn-Asp Proteins 0.000 description 1
- IVFUVMSKSFSFBT-NHCYSSNCSA-N Lys-Ile-Gly Chemical compound OC(=O)CNC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCCCN IVFUVMSKSFSFBT-NHCYSSNCSA-N 0.000 description 1
- JMNRXRPBHFGXQX-GUBZILKMSA-N Lys-Ser-Glu Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O JMNRXRPBHFGXQX-GUBZILKMSA-N 0.000 description 1
- DLAFCQWUMFMZSN-GUBZILKMSA-N Met-Arg-Ala Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C)C(O)=O)CCCN=C(N)N DLAFCQWUMFMZSN-GUBZILKMSA-N 0.000 description 1
- GPAHWYRSHCKICP-GUBZILKMSA-N Met-Glu-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O GPAHWYRSHCKICP-GUBZILKMSA-N 0.000 description 1
- 101100063504 Mus musculus Dlx2 gene Proteins 0.000 description 1
- 108010079364 N-glycylalanine Proteins 0.000 description 1
- 101150082943 NAT1 gene Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 101150022822 OSH15 gene Proteins 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 241001442654 Percnon planissimum Species 0.000 description 1
- 101000854546 Petunia hybrida Protein WUSCHEL Proteins 0.000 description 1
- MGBRZXXGQBAULP-DRZSPHRISA-N Phe-Glu-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 MGBRZXXGQBAULP-DRZSPHRISA-N 0.000 description 1
- 108700001094 Plant Genes Proteins 0.000 description 1
- 241000201976 Polycarpon Species 0.000 description 1
- XZONQWUEBAFQPO-HJGDQZAQSA-N Pro-Gln-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XZONQWUEBAFQPO-HJGDQZAQSA-N 0.000 description 1
- PRKWBYCXBBSLSK-GUBZILKMSA-N Pro-Ser-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O PRKWBYCXBBSLSK-GUBZILKMSA-N 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 101100084449 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PRP4 gene Proteins 0.000 description 1
- KYKKKSWGEPFUMR-NAKRPEOUSA-N Ser-Arg-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KYKKKSWGEPFUMR-NAKRPEOUSA-N 0.000 description 1
- VGNYHOBZJKWRGI-CIUDSAMLSA-N Ser-Asn-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CO VGNYHOBZJKWRGI-CIUDSAMLSA-N 0.000 description 1
- SFZKGGOGCNQPJY-CIUDSAMLSA-N Ser-Asp-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)N SFZKGGOGCNQPJY-CIUDSAMLSA-N 0.000 description 1
- SWSRFJZZMNLMLY-ZKWXMUAHSA-N Ser-Asp-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O SWSRFJZZMNLMLY-ZKWXMUAHSA-N 0.000 description 1
- VMLONWHIORGALA-SRVKXCTJSA-N Ser-Leu-Leu Chemical compound CC(C)C[C@@H](C([O-])=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CO VMLONWHIORGALA-SRVKXCTJSA-N 0.000 description 1
- XNXRTQZTFVMJIJ-DCAQKATOSA-N Ser-Met-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O XNXRTQZTFVMJIJ-DCAQKATOSA-N 0.000 description 1
- UPLYXVPQLJVWMM-KKUMJFAQSA-N Ser-Phe-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O UPLYXVPQLJVWMM-KKUMJFAQSA-N 0.000 description 1
- WLJPJRGQRNCIQS-ZLUOBGJFSA-N Ser-Ser-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O WLJPJRGQRNCIQS-ZLUOBGJFSA-N 0.000 description 1
- ZSDXEKUKQAKZFE-XAVMHZPKSA-N Ser-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N)O ZSDXEKUKQAKZFE-XAVMHZPKSA-N 0.000 description 1
- 102100033769 Sodium-coupled neutral amino acid transporter 3 Human genes 0.000 description 1
- IGROJMCBGRFRGI-YTLHQDLWSA-N Thr-Ala-Ala Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O IGROJMCBGRFRGI-YTLHQDLWSA-N 0.000 description 1
- VIBXMCZWVUOZLA-OLHMAJIHSA-N Thr-Asn-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O VIBXMCZWVUOZLA-OLHMAJIHSA-N 0.000 description 1
- VUVCRYXYUUPGSB-GLLZPBPUSA-N Thr-Gln-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N)O VUVCRYXYUUPGSB-GLLZPBPUSA-N 0.000 description 1
- CQNFRKAKGDSJFR-NUMRIWBASA-N Thr-Glu-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O CQNFRKAKGDSJFR-NUMRIWBASA-N 0.000 description 1
- IVDFVBVIVLJJHR-LKXGYXEUSA-N Thr-Ser-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O IVDFVBVIVLJJHR-LKXGYXEUSA-N 0.000 description 1
- RIJPHPUJRLEOAK-JYJNAYRXSA-N Tyr-Gln-His Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N)O RIJPHPUJRLEOAK-JYJNAYRXSA-N 0.000 description 1
- SYFHQHYTNCQCCN-MELADBBJSA-N Tyr-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CC2=CC=C(C=C2)O)N)C(=O)O SYFHQHYTNCQCCN-MELADBBJSA-N 0.000 description 1
- LUMQYLVYUIRHHU-YJRXYDGGSA-N Tyr-Ser-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LUMQYLVYUIRHHU-YJRXYDGGSA-N 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 230000009418 agronomic effect Effects 0.000 description 1
- 108010070944 alanylhistidine Proteins 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- 210000003484 anatomy Anatomy 0.000 description 1
- 108010008355 arginyl-glutamine Proteins 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 108010077245 asparaginyl-proline Proteins 0.000 description 1
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 1
- 239000002363 auxin Substances 0.000 description 1
- 230000027455 binding Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 210000003710 cerebral cortex Anatomy 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000003763 chloroplast Anatomy 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000002153 concerted effect Effects 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 210000005257 cortical tissue Anatomy 0.000 description 1
- UQHKFADEQIVWID-UHFFFAOYSA-N cytokinin Natural products C1=NC=2C(NCC=C(CO)C)=NC=NC=2N1C1CC(O)C(CO)O1 UQHKFADEQIVWID-UHFFFAOYSA-N 0.000 description 1
- 239000004062 cytokinin Substances 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 230000005014 ectopic expression Effects 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 230000035784 germination Effects 0.000 description 1
- 239000003448 gibberellin Substances 0.000 description 1
- IXORZMNAPKEEDV-OBDJNFEBSA-N gibberellin A3 Chemical class C([C@@]1(O)C(=C)C[C@@]2(C1)[C@H]1C(O)=O)C[C@H]2[C@]2(C=C[C@@H]3O)[C@H]1[C@]3(C)C(=O)O2 IXORZMNAPKEEDV-OBDJNFEBSA-N 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 208000016861 hereditary angioedema type 3 Diseases 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- SEOVTRFCIGRIMH-UHFFFAOYSA-N indole-3-acetic acid Chemical compound C1=CC=C2C(CC(=O)O)=CNC2=C1 SEOVTRFCIGRIMH-UHFFFAOYSA-N 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000004777 loss-of-function mutation Effects 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000017653 meristem maintenance Effects 0.000 description 1
- 108700023046 methionyl-leucyl-phenylalanine Proteins 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 230000005868 ontogenesis Effects 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000029553 photosynthesis Effects 0.000 description 1
- 238000010672 photosynthesis Methods 0.000 description 1
- 210000000745 plant chromosome Anatomy 0.000 description 1
- 239000003375 plant hormone Substances 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000008672 reprogramming Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 238000001878 scanning electron micrograph Methods 0.000 description 1
- 230000008117 seed development Effects 0.000 description 1
- 238000005204 segregation Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 108010007375 seryl-seryl-seryl-arginine Proteins 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000012868 site-directed mutagenesis technique Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- HNONEKILPDHFOL-UHFFFAOYSA-M tolonium chloride Chemical compound [Cl-].C1=C(C)C(N)=CC2=[S+]C3=CC(N(C)C)=CC=C3N=C21 HNONEKILPDHFOL-UHFFFAOYSA-M 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 238000010792 warming Methods 0.000 description 1
Landscapes
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to methods for the use of the Arabidopsis "BREVIPEDICELLUS" (BP) gene for alteration of plant architecture, in particular alteration of the morphology of the inflorescence of a flowering plant. The methods of the present invention provide a means to alter the development of the peduncle, notably the inflorescence branches, and the pedicels that subtend the individual flowers as well as aspects of flower structure such as the style, and subsequent seed pods, of a flowering plant.
The invention also relates to methods to identify and isolate polynucleotides encoding genes with BP-related functions from other plant species and methods for utilizing said polynucleotides to alter the inflorescence of said plant species. Furthermore, the invention encompasses transgenic plants generated by the methods disclosed, and nucleotide sequences for use in generating the transgenic plants.
The invention also relates to methods to identify and isolate polynucleotides encoding genes with BP-related functions from other plant species and methods for utilizing said polynucleotides to alter the inflorescence of said plant species. Furthermore, the invention encompasses transgenic plants generated by the methods disclosed, and nucleotide sequences for use in generating the transgenic plants.
Description
METHODS FOR MODIFICATION OF PLANT INFLORESCENCE
ARCHITECTURE
FIELD OF THE INVENTION
The present invention relates to methods for altering plant architecture, and in particular the morphology of the inflorescence of a flowering plant, involving the use of the Ar~abidopsis "BREVIPEDICELLUS" (BP) gene and homologues thereof.
BACKGROUND OF THE INVENTION
Plant architecture plays a very important role in overall crop performance.
The characteristics of the inflorescence, flower, silique/fruit, and stem internodes have broad agronomic implications in the overall productivity of any crop plant.
Compact architecture can contribute to productivity. For example, flowering stalks or inflorescences that are compact in nature and do not shade lower photosynthetic tissue can allow for greater productivity. Similarly, a flowering stalk or inflorescence that is spread out may allow for more photosynthesis to take place during seed development within the flowering stalk. Thus, different inflorescence architectures may be desired for different crops.
Since most crop varieties have been derived directly or indirectly through breeding from wild species, productivity of crops may be affected by characteristics that are evolutionarily beneficial to wild species but impair performance in an agricultural setting. For example, well spread-out flowers and siliques with long pedicels on the inflorescence (along with genes controlling seed dispersal mechanisms such as shattering) may be evolutionarily beneficial to wild species, while in a crop setting this confers significant disadvantages in terms of overall productivity as measured by harvested seed.
An example of this is canola species, in which the shoot architecture, especially involving inflorescence and siliques, is not ideal for optimal productivity and recovery of seed. Though there have been concerted efforts to produce crop plants with ideal architecture, it has not been achieved in many crop species.
It widely known that the growth and developmental programs of a plant species control pedicel development and determine its length, attachment angle of the flowers and seed pods, and contribute significantly towards the overall architecture of the flower and/or inflorescence. Despite significant advances in the understanding of flower development, very little is known about the genetic and molecular control of pedicel development.
Plant architecture or morphology is a major determining factor in plant productivity under agricultural settings. Plant varieties that have well-defined morphology of a uniform nature and pattern are preferred since they are amenable to mechanical cultivation. In particular, plant species that produce seed are selected for the uniformity of the placement of seed forming structures (typically seed pods or cobs) to allow efficient mechanical harvesting of seed. Plant varieties are also selected on the basis of other seed forming characteristics, such as strong pods to ensure no seed is lost or dispersed prior to harvesting, or compact nature of the raceme of the plant that contains the seedpods. Not all plants have these ideal characteristics. Thus, there is a strong interest in modifying the placement of seed pods and overall physical characteristics of many seed plants to produce plants with desirable plant architecture and overall morphology. Compact plants, with clustered seed pods can provide many benefits for mechanical production of the crop, as well as lead to increased productivity.
Accordingly, control of plant form and plant architecture is a desirable goal for the industry.
The building blocks of the plant architecture (body plan) are composed of reiterative units referred to as phytomers and these are elaborated during different phases of development (Sussex, I. M. & Kerk, N. M. (2001) Curr.
Opin. Plant Biol. 4, 33-37). In Ai°abidopsis tlzaliaTZa, three types of phytomers have been described (Schultz, E. A. & Haughn, G. W. (1991) Plant Cell 3, 771-781.). The variations in the number of units and their size among these three main types of phytomers in different plant species contribute to the tremendous architectural diversity observed in flowering plants (Steeves, T. A. & Sussex, I.
M. (1989) Patterns in plant development (Cambridge University Press, Cambridge). The activity of the shoot apical meristem (SAM), together with additional meristems, regulates the growth and development of all three types of phytomers (Medford, J. L, Behringer, F. J., Callos, J. D. & Feldmann, K. A.
(1992)Plant Cell 4, 631-643 & Simon, R. (2001) Semin. Cell Dev. Biol. 12, 357-362). The SAM contains three major domains defined by cytoplasmic densities and cell division rates: the central zone (CZ), which is responsible for maintaining the pluripotent stem cells; the peripheral zone (PZ), which is involved in the production of lateral organs; and the rib zone (RZ), from which the bulk of the stem is derived (Bowman, J. L. & Eshed, Y. (2000) Trends Plant Sci. 5, 110-115). Recent studies in Arabidopsis have shown that several genes, including SHOOTMERISTEMLESS (STM), WUSCHEL and CLAVATA-family receptor kinases and their putative ligands define key functions in the SAM (Brand, U., Hobe, M. & Simon, R. (2001) BioEssays 23, 134-141., Long, J. A., Moan, E. L, Medford, J. I. & Barton, M. K. (1996) Nature 379,66-69., Mayer, K. F., Schoof, H., Haecker, A., Lenhard, A., Jurgens, G. & Laux, T.(1998) Cell 95, 805-815., & Clark, S. E. (2001) Nat. Mol. Cell Biol. 2, 276-284.) In Arabidopsis the inflorescence constitutes the major part of the shoot and thus contributes significantly to the overall shoot architecture. Several genes have been identified in Arabidopsis that play key roles in defining the architecture of the shoot/inflorescence. For example, dwarf plants with uniform effects on all phytomers have been associated with altered levels of or defects in the signaling pathways of certain plant hormones (gibberellins or brassinosteriods - Hedden, N. P. & Kamiya, Y. ( 1997) Annu. Rev. Plant Physiol.
Plant Mol. Biol. 48, 431-460., & Richards, D. E., King, K. E., Ait-ali, T. &
Harberd, N. P. (2001) Annu. Rev.Plant Physiol. Plant Mol. Biol. 52, 67-88., and references therein). The supershoot (Tantikanjana, T., Yong, J. W., Letham, D.
S., Griffith, M., Hussain, M., Ljung, K., Sandberg, G. & Sundaresan, V. (2001) Genes Dev 15, 1577-1588.) and altered meristem program (Chaudhury, A. M., Letham, S., Craig, S. & Dennis, E. S. (1993) Plant J. 4,907-916.) mutants display abnormally high levels of cytokinins and produce extensive branching and altered shoot and inflorescence architecture. Auxin polar transport mutants, such as pinformed (Okada, K., Ueda, J., Komaki, M. K., Bell, C. J. & Shimura, Y. (1991) Plant Cell 3, 677-684.) and pinoid (Bennett, S. R. M., Alvarez, J., Bossinger, G. ~ Smyth, D. R. (1995) Plant J. 8, 505-520.), form inflorescences that are reduced to pin-like structures that do not produce any lateral organs or meristems. A compact inflorescence is caused by the erecta. mutation, which involves a putative receptor kinase (Torii, K. U., Mitsukawa, N., Oosumi, T., Matsuura, Y., Yokoyama, R., Whittier, R. F. & Komeda, Y. (1996) Plant Gell 8, 735-746.).
ARCHITECTURE
FIELD OF THE INVENTION
The present invention relates to methods for altering plant architecture, and in particular the morphology of the inflorescence of a flowering plant, involving the use of the Ar~abidopsis "BREVIPEDICELLUS" (BP) gene and homologues thereof.
BACKGROUND OF THE INVENTION
Plant architecture plays a very important role in overall crop performance.
The characteristics of the inflorescence, flower, silique/fruit, and stem internodes have broad agronomic implications in the overall productivity of any crop plant.
Compact architecture can contribute to productivity. For example, flowering stalks or inflorescences that are compact in nature and do not shade lower photosynthetic tissue can allow for greater productivity. Similarly, a flowering stalk or inflorescence that is spread out may allow for more photosynthesis to take place during seed development within the flowering stalk. Thus, different inflorescence architectures may be desired for different crops.
Since most crop varieties have been derived directly or indirectly through breeding from wild species, productivity of crops may be affected by characteristics that are evolutionarily beneficial to wild species but impair performance in an agricultural setting. For example, well spread-out flowers and siliques with long pedicels on the inflorescence (along with genes controlling seed dispersal mechanisms such as shattering) may be evolutionarily beneficial to wild species, while in a crop setting this confers significant disadvantages in terms of overall productivity as measured by harvested seed.
An example of this is canola species, in which the shoot architecture, especially involving inflorescence and siliques, is not ideal for optimal productivity and recovery of seed. Though there have been concerted efforts to produce crop plants with ideal architecture, it has not been achieved in many crop species.
It widely known that the growth and developmental programs of a plant species control pedicel development and determine its length, attachment angle of the flowers and seed pods, and contribute significantly towards the overall architecture of the flower and/or inflorescence. Despite significant advances in the understanding of flower development, very little is known about the genetic and molecular control of pedicel development.
Plant architecture or morphology is a major determining factor in plant productivity under agricultural settings. Plant varieties that have well-defined morphology of a uniform nature and pattern are preferred since they are amenable to mechanical cultivation. In particular, plant species that produce seed are selected for the uniformity of the placement of seed forming structures (typically seed pods or cobs) to allow efficient mechanical harvesting of seed. Plant varieties are also selected on the basis of other seed forming characteristics, such as strong pods to ensure no seed is lost or dispersed prior to harvesting, or compact nature of the raceme of the plant that contains the seedpods. Not all plants have these ideal characteristics. Thus, there is a strong interest in modifying the placement of seed pods and overall physical characteristics of many seed plants to produce plants with desirable plant architecture and overall morphology. Compact plants, with clustered seed pods can provide many benefits for mechanical production of the crop, as well as lead to increased productivity.
Accordingly, control of plant form and plant architecture is a desirable goal for the industry.
The building blocks of the plant architecture (body plan) are composed of reiterative units referred to as phytomers and these are elaborated during different phases of development (Sussex, I. M. & Kerk, N. M. (2001) Curr.
Opin. Plant Biol. 4, 33-37). In Ai°abidopsis tlzaliaTZa, three types of phytomers have been described (Schultz, E. A. & Haughn, G. W. (1991) Plant Cell 3, 771-781.). The variations in the number of units and their size among these three main types of phytomers in different plant species contribute to the tremendous architectural diversity observed in flowering plants (Steeves, T. A. & Sussex, I.
M. (1989) Patterns in plant development (Cambridge University Press, Cambridge). The activity of the shoot apical meristem (SAM), together with additional meristems, regulates the growth and development of all three types of phytomers (Medford, J. L, Behringer, F. J., Callos, J. D. & Feldmann, K. A.
(1992)Plant Cell 4, 631-643 & Simon, R. (2001) Semin. Cell Dev. Biol. 12, 357-362). The SAM contains three major domains defined by cytoplasmic densities and cell division rates: the central zone (CZ), which is responsible for maintaining the pluripotent stem cells; the peripheral zone (PZ), which is involved in the production of lateral organs; and the rib zone (RZ), from which the bulk of the stem is derived (Bowman, J. L. & Eshed, Y. (2000) Trends Plant Sci. 5, 110-115). Recent studies in Arabidopsis have shown that several genes, including SHOOTMERISTEMLESS (STM), WUSCHEL and CLAVATA-family receptor kinases and their putative ligands define key functions in the SAM (Brand, U., Hobe, M. & Simon, R. (2001) BioEssays 23, 134-141., Long, J. A., Moan, E. L, Medford, J. I. & Barton, M. K. (1996) Nature 379,66-69., Mayer, K. F., Schoof, H., Haecker, A., Lenhard, A., Jurgens, G. & Laux, T.(1998) Cell 95, 805-815., & Clark, S. E. (2001) Nat. Mol. Cell Biol. 2, 276-284.) In Arabidopsis the inflorescence constitutes the major part of the shoot and thus contributes significantly to the overall shoot architecture. Several genes have been identified in Arabidopsis that play key roles in defining the architecture of the shoot/inflorescence. For example, dwarf plants with uniform effects on all phytomers have been associated with altered levels of or defects in the signaling pathways of certain plant hormones (gibberellins or brassinosteriods - Hedden, N. P. & Kamiya, Y. ( 1997) Annu. Rev. Plant Physiol.
Plant Mol. Biol. 48, 431-460., & Richards, D. E., King, K. E., Ait-ali, T. &
Harberd, N. P. (2001) Annu. Rev.Plant Physiol. Plant Mol. Biol. 52, 67-88., and references therein). The supershoot (Tantikanjana, T., Yong, J. W., Letham, D.
S., Griffith, M., Hussain, M., Ljung, K., Sandberg, G. & Sundaresan, V. (2001) Genes Dev 15, 1577-1588.) and altered meristem program (Chaudhury, A. M., Letham, S., Craig, S. & Dennis, E. S. (1993) Plant J. 4,907-916.) mutants display abnormally high levels of cytokinins and produce extensive branching and altered shoot and inflorescence architecture. Auxin polar transport mutants, such as pinformed (Okada, K., Ueda, J., Komaki, M. K., Bell, C. J. & Shimura, Y. (1991) Plant Cell 3, 677-684.) and pinoid (Bennett, S. R. M., Alvarez, J., Bossinger, G. ~ Smyth, D. R. (1995) Plant J. 8, 505-520.), form inflorescences that are reduced to pin-like structures that do not produce any lateral organs or meristems. A compact inflorescence is caused by the erecta. mutation, which involves a putative receptor kinase (Torii, K. U., Mitsukawa, N., Oosumi, T., Matsuura, Y., Yokoyama, R., Whittier, R. F. & Komeda, Y. (1996) Plant Gell 8, 735-746.).
5 An even stronger effect on inflorescence architecture is conferred in a Laszdsberg erecta (Ler) background by the brevipedicellus (BP) mutation, which is defined by a recessive mutant with compact internodes and short, downward-pointing pedicels (Koornneef, M., Eden, J. v., Hanhart, C. J., Stain, P., Braaksma, F. J. & Feenstra, W. J. (1983) J. Hered. 74, 265-272). Thus, mutants that exhibit altered architecture provide an indication that architecture can be altered, but there is no indication as to the molecular nature of the gene or the mechanisms by which these changes are manifested.
The role of homeobox genes in defining body plan and their evolutionary relationships in animals is well documented (Gehring, W. J., Affolter, M. &
Burglin, T. (1994) Annu. Rev. Biochem. 63,487-526., Kappen, C. (2000) Proc.
Natl. Acad. Sci. USA 97, 4481-4486.) More recently, several plant knotted-like homeobox (KNOX) genes have been identified, which form two classes based upon sequence similarities and expression domains (Bharathan, G., Janssen, B., Kellogg, E. & Sinha, N. (1999) Mol. Biol. Evol. 16, 553-563., Reiser, L., Sanchez, B. P. & Hake, S. (2000) Plant Mol. Biol. 42, 151-166., Serikawa, K.
A., Martinet-Laborda, A. & Zambryski, P. (1996) Plant Mol. Biol. 32, 673-693.) In Arabidopsis, there are four different class I K1V0~ genes, STM, KNATl, KNAT~,and KNAT6 (Long, ibid., Lincoln, C., Long, J., Yamaguchi, J., Serikawa, K. & Hake, S. (1994) Plant Cell 6, 1859-1876. ~ Semiarti, E., Ueno, Y., Tsukaya, H., Iwakawa, H., Machida, C. & Machida, Y. (2001 ) Development 128, 1771-1783.) STM is expressed in the SAM, whereas KNATl and KNAT2 expression observed in the PZ of the SAM. KNATl is also expressed in the cortical cell layers of the peduncle and pedicel. STM, KNATl and KNAT2 expression is excluded from the leaf primordia and developing leaves by ASYMMETRICLEA TES 1 and 2 genes (Ori, N., Eshed, Y., Chuck, G., Bowman, J. L. & Hake, S. (2000) Development 127, 5523-5532., & Byrne, M., Barley, R., Curtis, M., Arroyo, J., Durham, M., Hudson, A. & Martienssen, R. (2000) Nature 408, 967-971 ). Ectopic expression of KNATI and KNAT2 in leaves induces altered symmetry and cell fate, and ectopic meristem/shoot formation from the adaxial surface (Chuck, G., Lincoln, C. & Hake, S. (1996) Plant Cell 8, 1277-1289). To date, loss-of function mutations in class I KNOX genes are known only for STM and these suggest a critical role in SAM maintenance and function. Significantly, however, no such mutations have previously been described for KIVATl , hampering study of the role of this homeobox gene in plant development.
The future prospects of engineering optimal plant architectures in plant species will depend on the availability of critical morphology controlling genes and knowledge of their functional regulatory properties. For example in canola, the occurrence of an inflorescence and silique with long pedicels may offer some unique challenges and opportunities to develop an ideal architecture for improving productivity.
In summary, there remains a continuing need to develop novel and efficient techniques for modifying the morphology and architecture of plants, such as for example Brassica and other plant types, to improve photosynthetic efficiency, overall yield, and harvestability. This need extends to both crops and to horticulturally grown species to improve aesthetic appeal.
SUMMARY OF THE INVENTION
The inventors of the present application have successfully identified the gene responsible for the brevipedicellus (bp) mutant in Arabidopsis. This mutation is known to give rise to plants having a very compact architecture with shortened siliques pointing downwards. Importantly, the inventors have realized that the successful identification of this gene has important implications on the generation of new crops and other plant species that exhibit advantageously modified morphological features.
In this regard, the inventors have discovered that the by mutation has several productivity advantages if introduced for example, into canola crop species. In Arabidopsis, the mutation results in reduced pedicel length, and siliques pointing downward with compact architecture. These features can improve exposure of upper leaves to sunlight and thereby enhance their photosynthetic efficiency: a well recognized problem in canola, especially during the pod setting and maturation stages. In addition, during harvesting the altered pod dynamics can reduce shattering losses, an important problem facing canola farmers. Further, the downward-pointing flowers may help in reducing disease incidence.
Therefore, the present invention relates, in one embodiment, to nucleic acid sequences derived from Arabidopsis encoding a homeobox gene involved in the control of inflorescence architecture, for use in modifying plant inflorescence architecture. In addition, the present invention relates in other embodiments to methods for modifying the morphological phenotype of plants, by introducing the nucleotide sequences encompassed by the present invention into a plant, and expressing the nucleotide sequences as appropriate.
In another embodiment, the present invention relates to nucleic acid sequences derived from A~°abidopsis encoding a homeobox gene involved in the control of inflorescence architecture, said homeobox gene differing from wild type by at least a change in an amino acid codon to produce a truncated protein.
The invention further relates to the proteins encoded by the nucleic acids encompassed by the invention, and their use.
The present invention also relates to methods for alteration of the expression of a native gene related to inflorescence structure, in particular the reduction in the expression of said gene.
In one aspect of the invention, nucleic acid sequences are provided that encode an altered protein that when expressed confers an altered inflorescence architecture phenotype in A~°abidopsis, particularly an inflorescence with. an altered pedicel, peduncle or style.
In one aspect of the invention, nucleic acid sequences are provided that encode an altered protein that when expressed confers an altered inflorescence architecture phenotype in Brassica, particularly an inflorescence with an altered pedicel, peduncle or style.
In another aspect of the present invention methods are described that enable the heterologous expression of the nucleic acid or portions or homologues thereof, described in SEQ ID NO: 5 in a host cell to obtain a plant with an altered inflorescence, more particularly an inflorescence with an altered pedicel, peduncle or style.
In yet another aspect of the present invention, methods are described wherein the nucleic acid sequence or regions thereof as described in SEQ ID
NO: 6 and nucleic acids homologous to same are used to alter the architecture of a flowering plant, in particular the inflorescence, more particularly the pedicel, peduncle or style.
In yet another aspect of the present invention, methods are described wherein nucleic acid sequence or regions thereof as described in SEQ ID. NO: 6 and nucleic acids homologous to same are used to alter the architecture of the inflorescence of a plant from the Crucifer (Cruciferae) family, particularly the pedicel, peduncle or style of said plant.
In yet another aspect of the present invention, methods are described wherein nucleic acid sequence or regions thereof as described in SEQ ID. NO: 6 and nucleic acids homologous to same are used to alter the architecture of the inflorescence of a plant from the Crucifer (Cruciferae) family, particularly the pedicel of said plant, said plant exhibiting an altered inflorescence, with compact internodes, downward pointing pedicels and siliques that point downward relative to the normal presentation of siliques.
In one embodiment, the present invention provides a method of producing a transgenic plant with a modified inflorescence architecture characterised in that the method comprises the steps of: (a) introducing into a plant cell capable of being transformed and regenerated into a whole plant a construct comprising, in 5 addition to the DNA sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNATI gene and encoding at least part of a KNATI gene product operably linked to a promoter; and (b) recovery of a plant which contains said nucleotide sequence and has a modified inflorescence architecture compared to an unmodified plant. Preferably, the 10 method involves nucleotide sequences encoding a peptide having at least 50%, preferably 70%, more preferably 90%, more preferably 95%, most preferably 99% homology to the peptide encoded by SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof. Preferably, the method involves nucleotide sequences that are able to bind under stringent conditions to SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof.
Preferably, the modification of inflorescence architecture comprises an altered pedicel, peduncle or style, and more preferably the altered pedicel has an altered length compared to an unmodified plant. Moreover, the modified inflorescence architecture preferably comprises downwardly pointing flowers.
In alternative embodiments, the invention provides methods characterised in that the nucleotide sequences are derived from a plant of the genus Arabidopsis or B~°assica and / or the transformed plants are of the genus Arabidopsis or Bnassica or are selected from the group consisting of: a dicot, a monocot, and a member of Cruciferae.
Preferably, the methods of the invention can generate a plant having either a compact or an open inflorescence compared to an unmodified plant. The nucleotide sequences may be expressed in a sense direction for complementary inhibition of an endogenous KNATI gene in the transgenic plant, such that the plant has a compact inflorescence architecture compared to an unmodified plant.
Preferably, the KNATl gene may be in a mutated form. In an alternative embodiment, the nucleotide sequence may be expressed in an antisense direction for antisense inhibition of an endogenous KNATI gene such that the plant has a compact inflorescence architecture and / or decreased pedicel length compared to an unmodified plant. In an further alternative embodiment, the nucleotide sequence may be overexpressed in a sense direction, such that the plant has an open inflorescence architecture and / or increased pedicel length compared to an unmodified plant.
In one aspect, the plant may harbour a by mutation such that expression of said nucleotide sequence is complementary to said mutation, inducing the plant exhibit a wild-type phenotype.
The promoters for use in accordance with the methods of the present invention may take various forms. For example, the promoter may comprise, in one embodiment a transcriptional regulatory region normally in operable association with an endogenous KNATI gene or homologue thereof. Alternatively, the promoter may comprise a transcriptional regulatory region that is not normally in operable association with an endogenous KNATI gene or homologue thereof.
Further, the promoter may be selected from the group consisting o~ a constitutive promoter, an inducible promoter, an organ specific promoter, a strong promoter, a weak promoter, and an endogenous KNATI promoter from Arabidopsis. Alternatively, the promoter may be derived from a functional portion of SEQ ID NO: 23 or SEQ ID NO: 24.
The present invention further encompasses methods for modifying the infloresence architecture of a plant involving the use of sequences homologous to SEQ ID NO: 5 or 6, such as, for example, SEQ ID NOS: 11, 14, 15, and 20.
In another embodiment, the present invention provides a method of identifying a plant that has been successfully transformed with a construct, characterised in that the method comprises the steps of (a) introducing into plant cells capable of being transformed and regenerated into whole plants a construct comprising, in addition to the DNA sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNATl gene and encoding at least part of a KNATI gene product, operably linked to a promoter; ,.(b) regenerating said plant cells into whole plants; and (c) inspecting the inflorescences of said plants to determine those plants successfully transformed with said construct, and expressing said nucleotide sequence. In a preferred embodiment, the plant cells and the regenerated whole plants harbour a by mutation, and successful transformation and expression of said nucleotide sequence complements said mutation, thereby generating a plant exhibiting a wild-type phenotype. More preferably, the construct is bicistronic and further comprises a second DNA
expression cassette for generating a transcript unrelated to said nucleotide sequence derived from a KNATI gene. In this way, the KNA TI-related portion of the construct can complement a known mutation in a plant and positively confirm transformation, and simultaneously a second transcript can be produced from a second region of the bicistronic construct, conferring desirable or otherwise properties to the transgenic plant.
The present invention further encompasses transgenic plants generated by any of the methods of the present invention. In this regard, the transgenic plants are preferably of the genus Anabidopsis or Br~assica or plants selected from the group consisting of a dicot, a monocot, and a member of Cruciferae. Moreover, the exogenous DNA or construct introduced into the plant may preferably be derived from plants of the genus Arabidopsis or Brassica.
The transgenic plants of the present invention preferably comprise a modified inflorescence (e.g. compact or open) compared to an unmodified plant.
Preferably the modified inflorescence architecture comprises an altered pedicel, peduncle or style, more preferably a plant with altered pedicel length or downwardly pointing flowers compared to an unmodified plant.
The present invention further encompasses, in other embodiments, isolated nucleotide sequences for generating a transgenic plant with modified inflorescence architecture, characterised in that the isolated nucleotide sequences are derived from a KNATI gene and encode at least part of a KNATI
gene product. The isolated nucleotide sequences preferably comprise a sequence selected from: (a) SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof; and (b) a nucleotide sequence encoding a peptide having at least 50%, preferably 70%, more preferably 90%, more preferably 95%, and most preferably 99% homology to the peptide encoded by the nucleotide sequence defined in (a).
Preferably the isolated nucleotide sequences of the present invention are characterised in that the nucleotide sequences hybridise under stringent conditions to the nucleotide sequence of SEQ ID NO: 5 or 6, or a part thereof or a complement thereof. The isolated nucleotide sequences for generating a transgenic plant with a modified inflorescence architecture compared to an unmodified plant, include sequences derived from a construct selected from the group consisting of: pRD400-951/955, pRD400-951/956, pRD400-35S::AtBPS, pRD400-35S::AtBPA/S, pRD400-35S::Atbp-2, pRD400-9511952::Atbp-2, pRD400-951/952::BnBPS, pRD400-35S::BnBPS, and pRD400-35S::BnBPA/S.
The present invention further encompasses, in further embodiments, the use of isolated nucleotide sequences related to the KNATl gene, for generating a transgenic plant with a modified inflorescence architecture.
BRIEF DESCRIPTIONS OF THE.DRAW1NGS
Figure 1. Illustration of the by BP phenotype in Arabidopsis. In this figure the phenotypes of 6 week-old Ler wt, bp-1 Ler and bp-2 Ler plants. (A)Whole plant:
Close-up of floral nodes with siliques of Ler wt (B) and bp-1 Ler (C). Close-up of inflorescence apex in Ler wt (D) and bp-1 Ler (E).
Figure 2. A comparison of internode and pedicel lengths between Ler wt, bp-1 Ler and bp-2 Ler. The histograms represent the percentage reduction in pedicel length for bp-1 and bp-2; the actual measurements in mm (mean values ~
standard deviation of 30 data points) are shown above,the corresponding bars.
The average pedicel lengths represent the values for the floral nodes 1-5. IN-l, IN-2, IN-3: coflorescence nodes l, 2, 3; FNl-5: floral nodes 1-5; FN6-10:
floral nodes 6-10.
Figure 3. SEM micrographs of inflorescences from Ler (A,B) and bp-1 Ler (C-E). (A) Ler wt floral nodes. (B) Ler wt peduncle internode magnified to show differentiated epidermal cells. (C) bp-1 floral nodes. (D,E) bp-I peduncle intemode showing stripes of less differentiated epidermal cells (arrows) that 5 originate below the node. Anatomy of the peduncle of Ler wt (F,H) and bp-I
(G,I). Cross sections through the internodal region of the peduncle of Ler wt (F) and bp-1 (G). Longitudinal sections through the nodal region of Ler wt (H) and bp-1 (I). Arrows in G demarcate a band of less differentiated cells that originate below the node, co, cortical cell layer; ad, adaxial; ab, abaxial. Bar = 0.1 mm 10 (A,B,D,E-I); 1 mm (C).
Figure 4. Pedicel development in Ler wt (A-E, K,L) and bp-1 Ler (F-J, M,N).
SEM of pedicel of stage 12 flower of Ler wt (A) showing complete epidermal cell differentiation on both the adaxial (B) and abaxial (C) sides. Pedicel of 15 stage 12 flower of bp-1 (F) with narrow distal end (E-), differentiated adaxial (G) and less differentiated abaxial (H) sides. SEM of stage 13 flower of Ler wt (D) and its pedicel (E). Stage 13 flower of bp-1 (I) and its pedicel (J) showing less differentiated abaxial side. Cross section through the mid-region of the pedicel of Ler wt (K) and bp-1 (L) and the distal end of the pedicel of Ler wt (M) and bp-1 (N). Bar =1 mm (A,D,F,I); 0.1 mm (B,C,E,G,H,J-N). ad, adaxial;
ab, abaxial. ' Figure 5. SEM of the style of a stage 17 flower of Ler wt (A}, and bp-1 Ler (D).
Longitudinal sections through the style of Ler (B) and bp-1 (E). Cross sections through the style of Ler wt (C) and bp-1 (F). Arrows in D-F indicate the lateral axis. Bar = 0.1 mm. sp, stigmatic papillae; st, style.
Figure 6. Southern blot and RT-PCR of KlVATl. (A) Southern blot. Genomic DNA from Col wt (lanes 1 and 2), Ler wt (lanes 3 and 4), RLD wt (lanes 5 and 6), bp-1 Ler (lanes 7 and 8), and bp-2 RLD (lanes 9 and 10) was digested with BamHI (lanes 1, 3, 5, 7, 9) or EcoRI (lanes 2, 4, 6, 8, 10).and probed with the KNATI cDNA. Sizes of the MW standards (kb) are indicated. (B) RT-PCR
using K1VAT1 primers 954 and 955. Lane 1, Col wt; lane 2, RLD wt; lane 3, Ler wt; lane 4, bp-1 Ler; lane 5, bp-2 Ler; lane 6, bp-2 RLD; lane 7, bp-2 Col.
The same cDNA pools were amplified with primers specific for gapC.
Figure 7. Sequences of the polymorphic regions of the BP-encoding cDNAs from Col wt, RLD wt, Ler wt, and bp-2. Numbering is shown for the Col wt sequence (GenBank U14174). Stop codons are indicated by an asterisk.(*), nucleotide and 25 amino acid deletions relative to Col wt are indicated by a dash (-), and nucleotide and amino acid insertions relative to Col wt are indicated in parentheses (). The C-T transition that causes a stop codon at position 535 in bp-2 is shown in bold. Nucleotides downstream of position 540 were identical among all of the BP-encoding genes analyzed and are not shown.
Figure 8. Vector map of the plant transformation vector referred to as pRD400-9511955, comprising of the KNAT1 cDNA cloned downstream of the putative KNATI promoter.
Figure 9. Vector map of the plant transformation vector referred to as pRD400-951/956, consisting of the putative KNATI promoter and the KNATI-encoding ORF amplified from genomic DNA.
Figure 10. Vector map of the plant transformation vector referred to as pRD400-35S::AtBPS, consisting of the A. thaliana BP ORF under the control of the 35S
promoter.
Figure 11. Vector map of the plant transformation vector referred to as pRD400-35S::AtBPA/S, consisting of the A. thaliana BP ORF in an antisense orientation under the control of the 35S promoter.
Figure 12. Vector map of the plant transformation vector referred to as pRD400-35S::Atbp-2, consisting of the altered BP gene coding sequence (SEQ
ID. NO: 6) under the control of the 35S promoter. The asterisk denotes the approximate location of the stop colon that results in a truncated predicted protein.
Figure 13. The vector pRD400-951/952::Atbp-2, consisting of the A. thaliana bp-2 cDNA under the control of the A. thaliana KNATI promoter. The asterisk denotes the approximate location of the stop colon that results in a truncated predicted protein.
Figure 14. The map of the vector of pRD400-951/952::BnBPS, consisting of the B, napus BP ORF (SEQ ID. NO: 11) under the control of the A. thaliana KNATI
promoter.
Figure 15. The vector map of pRD400-35S::BnBPS, consisting of the B. napus BP ORF (SEQ ID NO: 11) under the control of an optimized cauliflower mosaic virus (CaMV) 35S promoter.
Fig 16. The vector map pRD400-35S::BnBPA/S, consisting of the B. napus BP
ORF (SEQ ID NO: 1) in an antisense orientation under the control of the 35S
promoter.
DETAILED DESCRIPTION OF THE INVENTION
Definitions The singular forms "a," "an," and "the" include plural reference unless the context clearly dictates otherwise.
A "coding sequence" or "coding region" is the part of a gene that codes for the amino acid sequence of a protein, or for a functional RNA such as a tRNA or rRNA. A coding sequence typically represents the final amino acid sequence of a protein or the final sequence of a structural nucleic acid.
Coding sequences may be interrupted in the gene by intervening sequences, typically intervening sequences are not found in the mature coding sequence.
A "polynucleotide encoding an amino acid sequence" refers to a nucleic acid sequence that encodes the genetic code of at least a portion of a mature protein sequence, typically a contiguous string of amino acids typically linked through a peptide bond. An "amino acid sequence" is typically two or more amino acid residues, more typically 10 or more amino acids in a specific defined order.
A "complement" or "complementary sequence" is a sequence of nucleotides which forms a hydrogen-bonded duplex with another sequence of nucleotides according to Watson-Crick base-pairing rules. For example, the complementary base sequence for 5'-AGCT-3' is 3'-TCGA-5'.
"Expression" refers to the transcription of a gene into structural RNA
(rRNA, tRNA) or messenger RNA (mRNA) with subsequent translation into a protein in the case of the mRNA.
Polynucleotides are "functionally equivalent" if they perform substantially the same biological function. By substantially the same biological function it is meant that similar protein activities or protein function are encoded by a mRNA polynucleotide, or a structural polynucleotide has a similar structure and biological activity.
Polynucleotides are "heterologous" to one another if they do not naturally occur together in the same arrangement in the same organism. A
polynucleotide is heterologous to an organism if it does not naturally occur in its particular form and arrangement in that organism.
Polynucleotides or polypeptides have "homologous" or "identical"
sequences if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described herein. Sequence comparisons between two or more polynucleotides or polypeptides are generally performed by comparing portions of the two sequences over a portion of the sequence to identify and compare local regions.
The comparison portion is generally from about 20 to about 200 contiguous nucleotides or contiguous amino acid residues or more. The "percentage of sequence identity" or "percentage of sequence homology" for polynucleotides and polypeptides, such as 50, 60, 70, 80, 90, 95, 98, 99 or 100 percent sequence identity may be determined by comparing two optimally aligned sequences which may or may not include gaps for optimal alignment over a comparison region, wherein the portion of the polynucleotide or polypeptide sequence in the comparison may include additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
The percentage of homology or similarity is calculated by: (a) determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions; (b) dividing the number of matched positions by the total number of positions in the window of comparison; and, (c) multiplying the result by 100 to yield the percentage of sequence identity.
Optimal alignment of sequences for comparison may be conducted by computerized implementations of known algorithms, or by inspection. Readily available sequence comparison and multiple sequence alignment algorithms are, respectively, the Basic Local Aligmnent Search Tool (BLAST) (Altschul, S.F. et a11990. J. Mol. Biol. 215:403; Altschul, S.F. et a11997. Nucleic Acids Res.
25:
3389-3402) and ClustalW programs. BLAST is available on the Internet at http://www.ncbi.nlm.nih.gov and a version of ClustalW is available at http://www2.ebi.ac.uk. Other suitable programs include GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group (GCG), 575 Science Dr., Madison, WI). For greater certainty, as used herein and in the claims, "percentage of sequence identity" or "percentage of sequence homology" of amino acid sequences is determined based on optimal sequence alignments determined in accordance with the default values of the BLASTX program, available as described above.
Sequence. identity typically refers to sequences that have identical residues in order, whereas sequence similarity refers to sequences that have similar or functionally related residues in order. For example an identical polynucleotide sequence would have the same nucleotide bases in a specific nucleotide sequence as found in a different polynucleotide sequence. Sequence similarity would include sequences that are similar in character for example purines and pyrimidines arranged in a specific fashion. In the case of amino acid sequences, sequence identity means the same amino acid residues in a specific order, where as sequence similarity would allow for amino acids with similar chemical characteristics (for instance basic amino acids, or hydrophobic amino acids) to reside within a specific order.
The terms "stringent conditions" or "stringent hybridization conditions" includes reference to conditions under which a probe will hybridize to its target sequence, to a detectably greater degree than other sequences (e.g. at least 2-fold over background). Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. Generally, stringent conditions are selected to be about 5 ° C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH at which 50% of a complementary target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g. 10 to 50 nucleotides) and at least about 60°C for long probes (e.g. greater than 50 nucleotides).
Stringent conditions may also be achieved with the addition of destabilizing agents such as fonnamide. Exemplary low stringency conditions include hybridization with a buffer solution of 30% formamide, 1 M NaCI, 1 % SDS at 37°C, and a wash in 2X SSC at 50°C. Exemplary high stringency conditions include hybridization in 50% fonnamide, 1 M NaCl, 1% SDS at 37°C, and a wash in O.1X SSC at 60°C. Hybridization procedures are well-known in the art and are described in Ausubel et al.,(Ausubel F.M., et x1.,1994, Current Protocols in Molecular Biology, John Wiley & Sons Inc.).
"Isolated" refers to material that is: (1) substantially or essentially free from components which normally accompany or interact with it as found in its naturally occurring environment; or (2) if in its natural environment, the material has been non-naturally altered to a composition and/or placed at a locus in the cell not native to a material found in that environment. The isolated material optionally comprises material not found with the material in its natural environment. For example, a naturally occurring nucleic acid becomes an isolated nucleic acid if it is altered, or if it is transcribed from DNA which is altered, by non-natural, synthetic methods performed within the cell from which it originates.
Two DNA sequences are "operably linked" if the linkage allows the two sequences to carry out their normal functions relative to each other. For instance, a promoter region would be operably linked to a coding.sequence if the promoter were capable of effecting transcription of that coding sequence and said coding sequence encoded a product intended to be expressed in response to the activity of the promoter.
A "polynucleotide" is a sequence of two or more deoxyribonucleotides (in DNA) or ribonucleotides (in RNA).
A "DNA construct" is a nucleic acid molecule that is isolated from a naturally occurring gene or which has been modified to contain segments of nucleic acid which are combined and juxtaposed in a manner which would not normally otherwise exist in nature.
A "polypeptide" is a sequence of two or more amino acids.
A "homeobox" gene is a gene that is typically involved the developmental process of an organism, and usually contains one or more specific regions within the encoded protein that include a DNA binding region and a. second region that is distinct from the binding region. Homeobox genes typically contain a homoedomain that is homologous or has similarity to other homeodomain found in other homeobox genes.
A "promoter" or transcriptional regulatory region is a cis-acting DNA
sequence, generally located upstream of the initiation site of a gene, to which RNA polymerase may bind and initiate correct transcription.
A "recombinant" polynucleotide, for instance a recombinant DNA
molecule, is a novel nucleic acid sequence formed through the ligation of two or more nonhomologous DNA molecules (for example a recombinant plasmid containing one or more inserts of foreign DNA cloned into it).
"Transformation" means the directed modification of the genome of a cell by the external application of recombinant DNA from another cell of different genotype, leading to its uptake and integration into the subject cell's genome.
A "transgenic plant" encompasses all descendants; hybrids, and crosses thereof, whether reproduced sexually or asexually, and which continue to harbour the foreign DNA.
10 An inflorescence is a portion of a flowering plant that produces and supports flower development and typically seed formation. An inflorescence is usually formed from a meristem structure. The terms "inflorescence" and "flowering stalk" are used interchangeably herein.
Unless defined otherwise all technical and scientific terms used herein 15 have the same meaning as commonly understood to one of ordinary skill in the art to which this invention belongs.
The present application describes nucleic acids encoding a gene from A~abidopsis referred to as the BP gene, or the gene encoding the b~evipedicellus 20 phenotype, and the role of said gene in determining inflorescence morphology.
Said gene is a member of the KNOX gene family in Arabidopsis that is involved in control of certain aspects of flower development. The gene identified in the present invention represents an altered form of the wild-type gene. As a result of the present discovery, it was found that the wild-type gene is normally 25 involved in the control of the architecture of the inflorescence or at least the pedicel, peduncle and style structures within the inflorescence.
The gene sequences responsible for the by phenotype have not been previously identified and hence the molecular nature of the by mutation was not known prior to this disclosure. Accordingly, the utility of the by mutation for practical purposes has not been described. The present invention identifies the molecular basis of the by mutation and methods for using the gene encoded by the BP locus in alteration of plant inflorescence structure.
The present application further describes the discovery that the alteration in the expression levels of said gene, in particular the reduction in expression of said gene, or expression of an altered protein form of said gene results in changes in the inflorescence structure. Loss of function of said gene results in a compact inflorescence structure with changes in the length of the internodes, pedicle length and angle of seed pod attachment. The invention also provides evidence that gain of function can restore a wild-type phenotype, hence providing direction on alteration of inflorescence structure towards a compact structure or a structure that exhibits a less compact, more spread out structure.
The present application further describes the molecular basis of two loss of function alterations, providing a basis for the engineering of altered inflorescence architecture. In the present invention, the methods for the alteration of inflorescence architecture were shown to be: loss of the expression of the gene itself (inhibition of gene expression); and loss of function by expression of an altered form of the protein (expression of altered protein).
Accordingly, it is anticipated that the engineering of similar loss of function phenotypes in numerous flowering plant species can be easily and routinely accomplished by the use of methods described herein to identify, modify and alter the expression of the normally encoded gene or genes related to said nucleic acid sequences described herein. Thus, the present invention encompasses plants with altered inflorescence structures, in particular plants with an altered pedicel, peduncle or style can be obtained, alone or in combination, to produce an altered inflorescence structure.
Portions of the gene sequence representing the native wild-type protein coding sequence described in the present invention were found to be identical to the previously identified homeobox gene called KIVATl, but the involvement of the KNATI gene in the control of the inflorescence architecture or its association with the by phenotype have not previously been described nor anticipated.
Indeed, the previous studies (Lincoln et al, Plant Cell, 6: 1859- 1876, 1994) on the KNATI gene expression failed to identify a primary role for the gene in inflorescence architecture, suggesting that the expression of the KNATI gene was restricted in its expression in the inflorescence. No indication of the role of KNATI in peduncle, pedicle or style formation was suggested. Efforts to determine the function of the KNATI gene in this study were restricted to ectopic constitutive expression of the KNATl native coding sequence. No loss of function information for the KNATI was provided hence no definition of the nature of the activity of KIVATl could be inferred from these studies.
Accordingly the art did not describe a function for the KNATl gene, nor for that matter link the expression of the KNATI gene with the by mutant.
The present invention has thus assigned function to the KNATl gene, identified altered forms of the KNATl gene as the basis of the BP phenotype and provides methods for the alteration of wild-type gene expression to produce altered inflorescence, in particular inflorescence structures with alterations in the peduncle, pedicel or style or combinations thereof.
The present invention encompasses the use of the KNATI gene, and parts thereof, complements thereof, and homologues thereof, for generating transgenic plants with altered inflorescence structures. The present invention also encompasses the use of nucleic acid sequences encoding peptides having at least 50% homology, preferably 70% homology, preferably 90%, more preferably 95%, most preferably 99% to the peptides encoded by the KNATI
gene or SEQ ID NOS: 5 and 6. In this regard, homologous proteins with at least 50% or 70% predicted amino acid sequence homology are expected to encompass proteins with activity as those defined by the present invention, wherein disruption of expression or overexpression of the homologous proteins is expected to generate plants with altered structure as described in the present application. Such proteins may be derived from similar or unrelated species of plant.
The present invention also encompasses polynucleotide sequences encoding peptides comprising at least 90%, 95% or 99% sequence homology to the peptides encoded by the KNATl gene or SEQ ID NOS: 5 and 6. This class of related proteins is intended to include close gene family members with very similar or identical catalytic activity. In addition, peptides with 90% to 99%
amino acid sequence homology may be derived from functional homologues of similar species of plant, or from directed mutations to the sequences disclosed in the present application.
The present invention demonstrates the utility of said nucleic acid sequences and altered forms of the protein encoded by said nucleic acid sequences in controlling inflorescence development and hence assigns a novel utility for the use of the KNATI gene, and homologues thereof; to alter floral structure in flowering plants.
The nucleic acid sequences provided in the present invention can be used to alter plant morphology by heterologous expression, for example, of the nucleic acid sequences shown in SEQ ID. NOS: 5 and 6 and other homologous sequences as described herein.
The nucleic acid sequence of SEQ ID. NO: 5 encodes a I~NAT1 protein that has been shown in the present invention to be involved in maintaining the normal development of an inflorescence of a flowering plant, wherein expression of the protein confers the normal architecture of the inflorescence of a flowering plant. The protein represents a member of the homeodomain proteins involved in the control of plant development.
The nucleic acid sequence of SEQ ID. NO: 6 encodes an altered form of the KNATl protein, herein referred to as the BP related protein that is preferentially expressed in the inflorescence of a flowering plant, wherein expression of the protein influences the architecture of the inflorescence of a flowering plant. This protein represents an altered member of the homeodomain proteins involved in the control of plant development.
The present invention encompasses the expression of nucleotide sequences derived from the KNATI gene, includingSEQ ID Nos. 5 and 6 or homologues thereof to alter the inflorescence of a flowering plant by using said' polynucleotides to alter the expression of the protein normally expressed by KNATl and related genes using methods familiar to those of skill in the art.
In one aspect of the present invention, a gene sequence is used to modify the architecture of a inflorescence in a flowering plant by heterologous expression of the coding sequence of SEQ ID. NO: 6 or parts thereof, or complements thereof, or homologues thereof.
In another aspect of the present invention, one or more portions, of at least 50 amino acids, but less than 400 amino acids, most preferably about 179 amino acids of the protein encoded by the nucleic acid sequence of SEQ ID.
NO: 6 are expressed in a host plant, said expression causing the alteration of 10 inflorescence architecture as illustrated herein.
In another aspect of the present invention, the nucleic acid sequence, or coding region thereof described in the KNATI gene or in SEQ ID NO: 5 or 6 can used to modify the inflorescence of a flowering plant by using said sequence to 15 isolate a homologous nucleic acid that encodes a protein that is at least 50%
homologous to the protein encoded by SEQ ID. NO: 6 and expressing said homologous nucleic acid as part of a recombinant DNA construct in a host plant species. The recombinant DNA construct so expressed is engineered to express an altered form of the wild-type protein, or engineered to reduce the expression 20 of the wild-type gene. Method for the identification and isolation of homologous DNA sequences are very well known in the art and are included, for example in Sambrook et al., Molecular Cloning: A LaboYatofy Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y.(1989).
25 It will also be understood to a person of skill in the art that site-directed mutagenesis techniques are readily applicable to the polynucleotide sequences of the present invention, to make the sequences better suited for use in generated morphologically modified transgenic plants. Related techniques are well understood in the art, for example as provided in Sambrook et al., Moleculaf-Cloning: A Labof-atofy Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y.(1989). In this regard, the present invention teaches the use of nucleotide sequences derived from the I~NAT1 gene, including, for example SEQ ID NOS:
5 and 6. However, the present invention is not intended to be limited to these specific sequences. Numerous directed mutagenesis techniques would permit the non-informed technician to alter one or more residues in the nucleotide sequences, thus changing the subsequently expressed polypeptide sequences.
Moreover, commercial 'kits' are available from numerous companies that pernlit directed mutagenesis to be carried out (available for example from Promega and Biorad). These include the use of plasmids with altered antibiotic resistance, uracil incorporation and PCR techniques to generate the desired mutation. The mutations generated may include point mutations, deletions and truncations as required. The present invention is therefore intended to encompass corresponding mutants of the KNAT1 gene, both cDNA and genomic DNA
sequences in accordance with the teachings of the present application.
The polynucleotide sequences of the present invention must be ligated into suitable vectors before transfer of the genetic material into plants. For this purpose, standard ligation techniques that are well known in the art may be used.
Such techniques are readily obtainable from any standard textbook relating to protocols in molecular biology, and suitable ligase enzymes are commercially available.
In another aspect of the present invention, 'the KIVATl gene sequence, and parts, complements, and homologues thereofare used to modify a plant inflorescence by the transformation of plant cells With a plant transformation vector comprising a coding, for example, a region of said nucleic acid described in SEQ ID. NO: 6 under the control of a heterologous or native/homologous promoter.
In another aspect of the present invention, the nucleic acid sequence described in SEQ ID. NO: 6 is used to modify plant inflorescence architecture by the transformation of plant cells with a plant transformation vector comprising a coding region of said polynucleotide under the control of the promoter normally associated with the nucleic acid sequence found in SEQ ID
NO: 6.
In one aspect of the present invention, the nucleic acid described in SEQ
ID NO: 6 is used to alter the phenotype of an Ai°abidopsis plant by introduction of said nucleic acid or portion thereof into an As-abidopsis plant and recovering a plant wherein the inflorescence architecture of the plant has changed as a result of the introduction of the nucleic acid sequence, or portion thereof into the plant.
In one aspect of the invention these nucleic acid sequences may be used for identification of related homologous sequences deposited in public databases through comparative techniques well-known in the art, or as a hybridization probe for the identification of related cDNA or genomic sequences from various species, including plant species where the DNA sequence information is not known. In particular it is contemplated that these sequences so described can be used for the isolation of plant genes encoding similar activities.
In another aspect of the present invention, nucleic acids encoding a protein at least 50% homologous to the protein encoded by SEQ ID. NO: 6 are isolated and said nucleic acids are used to alter the phenotype of the inflorescence of the plant species from which they were derived by introduction of said nucleic acid or portion thereof into said plant species and recovering a plant wherein the inflorescence architecture of the plant has changed as a result of the introduction of the nucleic acid sequence, or portion thereof into the plant species.
In another aspect of the present invention, said nucleic acids that encode . a protein at least 50% homologous to the protein encoded by SEQ ID. NO: 6 are used to alter the inflorescence architecture of a flowering plant by introduction of said nucleic acid into a plant species heterologous to the plant species from which said nucleic acid sequence was derived.
In yet another aspect of the present invention, the nucleic acid sequence described in SEQ ID. NO: 6 is used as a visible marker for plant transformation, said marker producing plants with an altered inflorescence architecture relative to plants not transformed with the same.
In order to isolate. nucleic acid sequences involved in inflorescence architecture, mutant plant lines with altered inflorescence architecture were analyzed. A mutant in Arabidopsis designated as by has been described that exhibits a significant reduction in pedicel length (~80-90%) along with shortening in the intemodal regions (40-60%). The by mutant was first described by Koornneef et al in 1983 (ibid.) and has been used extensively in mapping studies as a classical chromosome 4 marker. However, no studies explaining the developmental or molecular basis of this mutation have been published to date.
In the present invention, mutant alleles of this gene were isolated by screening T-DNA insertional lines for by phenotypes. A line was found that showed a by mutant phenotype. As described herein, this isolated line was designated as bp-2 and the Koornneef isolate as bp-1. Thus, a new by mutation was discovered by the present inventors.
In order to establish the basis of the new mutation, pure lines with single recessive alleles of bp-1 and bp-2 were established in Arabidopsis ecotypes Landsberg erecta (Ler) and Columbia (col).
These lines were analyzed for architectural changes by Scanning Electron Microscopy (SEM) and the results indicated that epidermal cell differentiation is affected in both pedicel and internodes. Detailed SEM
analysis of the pedicel showed that in the abaxial region (lower side), epidermal cell differentiation is more affected compared to the adaxial region (upper side) in addition to an overall reduction in cell divisions along the whole pedicel.
Thus, the more pronounced abaxial changes in differentiation coupled with reduced cell division contribute to the change in the pedicel attachment angle and as a result produced shortened siliques (seed pods) pointing downwards in the BP
mutant. This provides an architectural change in the morphology of the pedicel, leading to a plant with an altered inflorescence.
Cross sections through the internodal regions showed that in addition to alterations in epidermal cell differentiation, the sub-epidermal cortical region was changed in by lines. In these lines, this region showed more intercellular spaces with larger cortical cells. Analysis of pedicel cross sections also revealed similar changes. Analysis of longitudinal sections through the nodes showed there were fewer cells (between floral nodes) in the by lines compared to wild-type lines. The presence of fewer cells in the internodes is indicative of reduced cell divisions in this region, consistent with the significantly reduced internodal 5 length in the by lines.
The anatomical analysis clearly demonstrates that changes in cell differentiation coupled with reduced cell division contributes to the altered, compact architectural phenotype in the by lines. Accordingly, the changes in the 10 architecture of the plant as a result of the BP mutation (or loss of its function) provide a new and valuable phenotype for flowering plants with a compact inflorescence and downward pointing seed pods.
Genetic analysis established that bp-2 is allelic to bp-1 previously 15 mapped on chromosome 4. The bp-2 mutant phenotype is not physically linked to the T-DNA. The present inventors used a novel strategy of positional cloning to isolate the gene sequences associated with the by phenotype.
The available genetic and recombination data suggest that the by locus is 20 located in between the marker DET2 and the centromere on chromosome 4. The genomic sequence corresponding to this region (~1.5 Mb) has been determined.
To clone the BP gene, a region between DETl and the centromere on chromosome 4 was chosen, based on genetic maps compiled from several data sets (http:llwww.Arabidopsis.org; (Pepper, A., Delaney, T., Washburn, T., 25 Poole, D. & Chory, J. (1994) Cell 78 ). As the loss-of function BP mutation mainly affects the pedicel and internodal regions but not the leaves, the BP
transcripts are also likely differentially expressed. Probes corresponding to differentially expressed transcripts were prepared from the pedicel and internodal region and were used for subtraction hybridization with leaf expressed transcripts to identify potential BP candidate genes from this ~1.5 Mb genomic region.
Radioactively labeled probes representing the transcripts preferentially . expressed in the pedicel and intemodal region were generated and hybridized the probes to restriction-digested overlapping BAC DNAs completely covering this region of chromosome 4. The results showed a single hybridizing band representing a ~20-kb BamHI fragment from BAC clone F9M13 (Mayer KFX, Schiiller CME, et al. (1999) Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana. Nature 402:769-777.) The annotation and BLAST analysis of this ~20 kb sequence showed only one potential gene, with 100% identity to the previously reported homeodomain containing protein KNATI (Lincoln, C., Long, J., Yamaguchi, J., Serikawa, I~. 8z Hake, S. (1994) Plant Cell 6, 1859-1876.).
Previous reports in the art have mapped the KNATl gene to chromosome 5, however, the assignment of the chromosomal location of the KIVATl gene has now been found to be in error. Utilizing the sequence comparison available based on screening the whole Arabidopsis genome demonstrated that the KNATI
gene as well as the sequence of the BAC clone F9M13 containing the BP gene to be located on chromosome 4. Thus, it was established that the KNATI gene resides on chromosome 4, not 5 as previously reported.
This discovery shows that the previously described KNATI gene, formerly thought to be on chromosome 5 and encoding a protein previously thought to be involved in 'various facets of plant development, is the gene affected in the by mutation and is in fact intimately involved in the control of inflorescence architecture.
Whereas the previous study with the ~KNATI gene demonstrated that overexpression of the coding region of the gene (cDNA) under CaMV 35S
promoter produced several abnormal phenotypes including the ectopic production of meristems from adaxial (upper) surface of the leaves and altered leaf shape, the involvement of KNATI in pedicel architecture and control of inflorescence was not reported. The art failed to provide correlation between KNATI and the by mutation herein described. Hence function of the I~NNAT1 gene was not assigned nor was the utility of the gene for controlling inflorescence architecture known or suggested. In addition, the chromosomal location of I~1VAT1 was also incorrectly reported further confusing the nature and utility of the KIVATl gene.
However, as described herein, the second by phenotype, bp-2 was unequivocally established as residing on chromosome 4 within the BAC F9M13 clone. Since the bf°evipedicellus (bp) mutation was described before the report of KNATI , the inventors adopted the BP designation for this locus, according to conventional practice.
To determine if sequence differences. existed between bp-1, bp-2 arid wild type plants at the BP locus, a Southern blot with restriction digested genomic DNAs as target and the BP (KNATl) cDNA as probe was carned out.
It was demonstrated that the bp-1 (Ler) lacks the BP (KNATI ) gene entirely, indicating that a deletion of this gene had occurred in this mutant. In contrast, bp-2 showed hybridizing bands similar to wild type. Thus bp-1 represents a deletion mutation of the BP gene, (or the KNATI gene) whereas bp-2 represents an alteration of the gene (and encoded protein) itself.
The expression of the BP transcripts in mutant and wt plants was analyzed. RT-PCR results confirm that bp-1 produces no BP transcript, while' bp-2 produces an apparently full-length transcript comparable to the wild type.
To identify the molecular basis for the bp-2 mutant phenotype, BP-encoding RT-PCR products from duplicate reverse transcription reactions using Ler (wt), RLD (wt), bp-~ (col), bp-2 (Ler), and bp-2 (RLD) were then cloned and their sequences determined.
In wt Ler and RLD the BP ORFs encoded predicted proteins of 400 amino acids, compared with a predicted protein of 398 amino acids for col wt.
Minor sequence polymorphisms among the three wild-type BP cDNAs were detected, some of which resulted in differences in the predicted proteins. The BP gene, or KNATI gene contains two domains, a homeodomain , and an ELK
region as typically found in plant and animal homeobox genes.
Changes were noted between wild-type and mutant BP proteins (bp-2 protein from Ler, col and RLD by lines). In particular, the third and fourth asparagine/histidine-rich regions contained differing numbers of N residues among the three predicted proteins, which accounted for the differences in the' total number of amino acids. The predicted BP proteins from bp-2 (col), bp-2 (Ler), and bp-2 (RLD) were identical and contained several unique polymorphisms compared with the wt sequences, hence the altered protein structure of the protein encoded by the bp-2 gene, confering altered functionality. This similarity between the different bp-2 proteins is expected since the original bp-2 mutation was introgressed into these three backgrounds.
Interestingly, within the wt BP protein, minor polymorphisms were identified.
Thus, protein polymorphisms are found in both wt and bp-2 proteins. For example, the third N-rich region contained only three N residues in the bp-2 lines, compared with five in col (wt) and six each in Ler (wt) and RLD (wt).
Most importantly, bp-2 contained a C-T transition corresponding to position of the col (wt) ORF. This point mutation changed codon 179 from cag to tag, thereby introducing a stop codon and resulting in a truncated predicted protein.
The predicted BP protein of bp-2 is truncated upstream of both the important homeodomain and ELK regions, and as result this protein would not be expected to have normal function.
Further supporting evidence was obtained by transforming the bp-1 and bp-2 mutant lines with wild type BP genomic and cDNA constructs, which showed complementation of the mutant phenotype in transgenic plants and restoration of wild-type plant architecture.
In addition to simple complementation, control of inflorescence architecture can be regulated by expression levels of wt BP protein. The pedicels in col wt are much longer than Ler wt pedicels. Based on expression analysis, it was found that there is a 2-4 times higher transcript level of wt BP mRNA in col wt ecotype when compared to Ler wt, indicating that transcriptional regulation of BP contributes to the observed differences between these ecotypes. Thus, reducing the BP transcript levels can lead to a significant reduction in pedicel and internodal length. It is also desirable to increase the length of pedicel and/
or internodes by up-regulating the expression of BP functional homologues.
Thus, the results presented herein provide obvious strategies for the manipulation of inflorescence architecture.
Accordingly, the present invention ascribes a function to a previously identified homeobox gene, IfNATl, demonstrating that IfNATI encodes a gene normally involved in the control of inflorescence development. This invention also demonstrates that KNATI is located on chromosome 4, not 5 as previously 10 reported. In addition, this invention demonstrates the function of the KNATI
gene in pedicel architecture and demonstrates alterations in the coding sequence of the K1VAT1 gene can lead to a by phenotypes thus establishing KNATI as the BP gene.
15 For the purposes of the present invention, nucleic acid sequences encoding a protein with substantial homology of 50% or more to the protein encoded by Seq ID. NO: 5, said proteins at least differentially expressed in the inflorescence of a flowering plant, and having a role in regulating inflorescence architecture, are herein referred to as "BP" coding sequences, encoding a "BP"
20 protein. Hence a "BP gene" from a flowering plant represents a coding sequence substantially similar to the Seq ID. NO: 5 in both protein sequence and protein function.
A "BP" gene may or may not include the 5' and 3' regions normally 25 associated with said coding sequence, as a native "BP" gene will include at least functional portion of these regulatory regions, whereas a recombinant "BP"
gene will have at least one portion of the 3' or 5' regions altered by the addition of new DNA sequences. The alteration of the 5' or 3' regions of said BP gene will be at least expected to cause altered expression in the native plant species from which the BP gene was derived when compared to the expression of the wt BP
gene normally found in said plant species.
In one embodiment of the present invention, the expression of the BP
gene in a plant species is altered by the inhibition of expression of the native BP
gene coding sequence. Accordingly, it is one object of the present invention to alter the expression levels of the protein encoded by the BP gene normally found in a plant species by introduction of a recombinant BP gene~that alters the expression of the wt BP gene by reduction of the native BP gene expression and reduction of the levels of the protein encoded by the wt BP gene in said plant species.
It is a further embodiment of the present invention to alter the expression of a wt BP gene in a plant species by introduction of a recombinant version of said BP gene, said recombinant version altered by the addition of one of more DNA sequences that lead to the increased expression of said gene relative to the expression of the wt BP gene in said plant species, leading to the increased expression levels of the protein encoded by a wt BP gene coding sequence in said plant species.
It is still another embodiment of the present invention to express a non-native BP coding sequence in a plant species. Said non-native BP coding sequence can be an altered form of the BP coding region normally found in said plant species, or a BP functional homologue from a different plant species.
Expression of the non-native BP protein can be expected to alter the activity of the native BP protein by competition for DNA binding regions, or the non-native BP protein can encode an activity that provides a phenotypic distinction.
Accordingly, it is one embodiment of the present invention to alter the activity of the protein encoded by the BP gene normally found in a plant species is altered by introduction of a recombinant version of a non-native BP gene, said recombinant version altered by the addition of one of more DNA sequences that lead to expression of said gene in said plant species, leading to altered activity of the native BP protein. In the present case, altered activity of the BP protein is defined as changes in the inflorescence structure in plants that comprise the non-native BP gene.
Similarly, in a further embodiment of the present invention to alter the expression of a wt BP gene in a plant species by introduction of a recombinant non-native BP gene that alters the activity of the wt BP gene by reduction of the native BP gene expression and reduction of the expression of the protein encoded by the wt BP gene in said plant species.
The identification of this unique genetic activity and specific function allows for novel strategies to manipulate plant morphology or architecture.
The sequence can also be used to isolate corresponding related similar or identical sequences from other plant species. Related techniques are well understood in the art, for example as provided in Sambrook et al., Moleeula~ Clohing: A
Labof°atory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y.(1989).
The applications of this gene for engineering useful flower/inflorescence architectures in crop and economically important plant species include both the production of more compact flowering structures and conversely methods for the genetic reprogramming of inflorescence structure to produce less compact and more spreading floral structures useful for horticultural applications.
One preferred application is to develop a by phenotype in canola crop species (e.g. Bf~assica napus, B. rapa). A compact inflorescence architecture in canola will offer several advantages to this crop that may include reduced shattering and improved overall performance. As one aspect of the present invention, BP-related genes from canola have been isolated and are used to engineer by -phenotypes.
Similar strategies can be applied to other crop plants by using BP
functional homologues from the respective species. Engineering novel and useful architectures using BP or functional homologues is not limited to crop species; potential applications could be extended to horticultural plants to create aesthetically appealing flowers or inflorescences.
Accordingly, in one embodiment of the invention the subject method includes the steps of expressing a BP gene in a plant species comprising the steps of:
a) Introducing into a plant cell capable of being transformed a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in said cells, a DNA sequence derived from a KNATI gene, for example, that encodes a peptide having at least 50% homology to the peptide encoded bySEQ ID NO: 5, operably linked to a suitable transcriptional regulatory region and, b) recovery of a plant which contains said recombinant DNA, said plant exhibiting altered inflorescence architecture.
The suitable transcriptional regulatory region can be the regulatory region normally associated with the KNATl gene or BP coding sequence or a heterologous transcriptional regulatory region capable of expression in the inflorescence.
In another preferred embodiment of the invention the subject method includes a method for modifying the inflorescence architecture of a plant comprising:
(a) Introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA
sequences required for transformation and selection in plant cells, a DNA sequence that comprises a polynucleotide region derived from SEQ ID. NO: 5 or 6 encoding a BP gene sequence or part thereof, operably linked to a suitable transcriptional regulatory region and, (b) recovery of a plant which contains said recombinant DNA and has altered inflorescence architecture.
The chimeric gene is introduced into a plant cell and a plant cell recovered wherein said gene is integrated into the plant chromosome. The plant cell is induced to regenerate and a whole plant is recovered with altered inflorescence architecture.
The method further relies on the use of transformation to introduce the 5 gene encoding the enzyme into plant cells. Transformation of the plant cell can be accomplished by a variety of different means. Methods that have general utility include Agnobactez°iuzzz based systems, using either binary and cointegrate plasmids of both A. tuzzzifaciezzs and A. rhyzogenies. (e.g., US 4,940,838, US
5,464,763), the biolistic approach (e.g, US 4,945,050, US 5,015,580, US
10 5,149,655), microinjection, (e.g., US 4,743,548), direct DNA uptake by protoplasts, (e.g., US 5,231,019, US 5,453,367) or needle-like whiskers (e.g., US 5,302,523). Any method for the introduction of foreign DNA and/or genetic transformation of a plant cell may be used within the context of the present invention.
It is also apparent to one skilled in the art that the polynucleotide and deduced amino acid sequence of SEQ ID. NO: 5 or 6 can be used to isolate related genes from various other plant species. The similarity or identity of two polypeptide or polynucleotide sequences is determined by comparing sequences.
In the art, this is typically accomplished by alignment of the amino acid or nucleotide sequences and observing the strings of residues that match. The identity or similarity of sequences can be calculated by known means including, but not limited to, those described in Computational Molecular Biology, Lesk A.M., ed., Oxford University Press, New York, 1988, Biocomputin~:
Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993., Computer Analysis of Sequence Data, Part I, Griffin, A.M. and Griffin, H.G., eds., Humana Press, New Jersey, 1994 and other protocols known to those skilled in the art. Moreover, programs to determine relatedness or identity are codified in publicly available programs. One of the most popular programs comprises a suite of BLAST programs, three designed for nucleic acid sequences (BLASTN, BLASTX and TBLASTX), and two designed for protein sequences (BLASTP and TBLASTN) (Coulson, Trends in Biotechnology, 12:76-80, 1994). The BLASTX program is publicly available from NCBI and other sources such as the BLAST Manual, Altschul, S., et al., NCBI NLM NIH
Bethesda Maryland 20984, also http://www.ncbi.nlm.nih.govBLAST/blast help.html) provides online help and further literature references for BLAST and related protein analysis methods, and Altschul, S., et al., J. Mol. Biol 215:403-410, 1990.
Within the BP gene two regions are found, the homeodomain and the ELK region. Within the homeodomain region BP shares significant homology with number of other homeodomain proteins (approximately 50 in A~abidopsis), and also other plant and animal homeodomain proteins, thus the BP protein represents one of the many homeobox genes.
The isolated polynucleotide can be sequenced and the DNA sequence used to further screen DNA sequence collections to identify related sequences from other species. The DNA sequence collections can comprise EST sequences, genomic sequences or complete cDNA sequences.
In Arabidopsis the entire BP coding sequence shares the highest homology with STM which is implicated in meristem maintenance and function(41%), whereas outside ofA~abidopsis, it shares 53% homology with maize RSI and 52% with rice OSH15. These genes have been identified by utilizing the conserved domains of plant homeobox genes. Similarly, hybridization can be used to isolate BP functional homologues genes from other species. In the present invention, we have used probes derived from SEQ ID
NO: 5 to isolate cDNA sequences homologous to the BP gene of Ai°abidopsis.
The present inventors have isolated BP genes from BYassica aapus, B. oleracea and B. t°apa using hybridization. These Br-assica BP genes have been incorporated into plant transformation vectors and have been used to transform plants to obtain plants with altered inflorescence structures.
Accordingly, in one embodiment of the invention the subject method for modifying the inflorescence of a plant comprising the steps of a.) Introducing into a plant cell capable of being transformed a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in said cells, a DNA sequence that encodes a BP coding sequence encoding a peptide having of at least 50% sequence identity to the peptide encoded by SEQ ID.
NO: 5, operably linked to a suitable transcriptional regulatory region and;
b.) recovery of a plant which contains said recombinant DNA.
In another embodiment of the present invention, alteration of Brassica inflorescence structure is contemplated. Accordingly, the present invention encompasses a method for modifying the inflorescence of a Brassica plant comprising the steps of a.) Introducing into a Brassica plant cell capable of being transformed a genetic construct comprising a first DNA
expression cassette that comprises, in addition to the DNA
sequences required for transformation and selection in said cells, a DNA sequence that encodes a Brassica BP coding sequence encoding a protein of at least 50% sequence identity to the protein sequence encoded by SEQ ID. NO: 5, operably linked to a suitable transcriptional regulatory region and, b.) recovery of a Brassica plant which contains said recombinant DNA and exhibits an altered inflorescence.
The use of gene inhibition technologies such as antisense RNA or co-suppression or double stranded RNA interference is within the scope of the present invention. In these approaches, the isolated gene sequence is operably linked to a suitable regulatory element.
Accordingly, in one embodiment of the invention the subject method includes a method to modify the inflorescence of a plant comprising the steps of:
a.) Introducing into a plant cell capable of being transformed a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in said cells, a DNA sequence that encodes a BP coding sequence encoding a protein of at least 50%
sequence identity to the protein encoded by SEQ ID. NO: 5, at least a portion of said DNA sequence in an antisense orientation relative to the normal presentation to the transcriptional regulatory region, operably linked to a suitable transcriptional regulatory region such that said recombinant DNA construct expresses an antisense RNA or portion thereof of an antisense RNA and, b.) recovery of a plant which contains said recombinant DNA.
It is apparent to the skilled artisan that the polynucleotide encoding the sequence can be in the antisense (for inhibition by antisense RNA) or sense (for inhibition by co-suppression) orientation, relative to the transcriptional regulatory region, or a combination of sense and antisense RNA, to induce double stranded RNA interference (Chuang and Meyerowitz, PNAS 97: 4955-4990, 2000, Smith et al., Nature 407: 319 - 320, 2000).
A transcriptional regulatory region is often referred to as a promoter region and there are numerous promoters that can be used within the scope of the present invention. In addition, the skilled artisan will readily recognize that the sequence of the inserted recombinant gene must contain regions of sufficient homology to allow for sequence-specific inhibition of gene expression.
Another application for the BP gene is as a visible marker for plant transformation. The advantages of using selection systems that do not include antibiotic/herbicide resistance marker genes for producing transgenic plants are well recognized. Since the bp-1 null mutant represents a phenotype that is clearly visible and easily distinguishable from wild type plants, it is possible to develop transformation vectors based on the BP gene that are devoid of any antibiotic or herbicide selection markers to provide a novel and very efficient alternative to the currently available selection systems. As evidenced by the present invention, the use of the BP gene for complementation of the by phenotype in Arabidopsis demonstrates the it is possible to select for plants that have received a BP gene as a result of transformation with said gene.
5 It is apparent to the skilled practitioner that any number of methods for the construction of a heterologous genetic construct encoding the protein or portion thereof encoded by SEQ ID. NO: 5 or homologues thereof can be used to alter the architecture of plant wherein said DNA construct has been introduced.
The following examples serve to illustrate the method and in no way limit the utility of the invention.
Example 1: Construction and Analysis of Arabidopsis by Mutant Lines.
Plant material and genetic analysis. Plants were grown at 22°C (90%
relative humidity) under fluorescent and incandescent light at ~60 ~.E/m 2 /s with 16 h days. The by mutant seeds were obtained from the Arabidopsis Biological Resources Center (ABRC), Ohio State University (stock number CS30;
(Koornneef, M., Eden, J. v., Hanhart, C. J., Stam, P., Braaksma, F. J. &
Feenstra, W. J. (1983) J. Hered. 74, 265-272.)). This allele was designated bp-1.
A second by allele (bp-2) was isolated from promoter-tagged Af~abidopsis lines in RLD background. This allele was introgressed into Ler and backcrossed five times with wild type (wt). bp-2 was introduced into Columbia (Col) wt background from Ler and backcrossed three times.
Histology. Plant samples were fixed for 24 h at room temperature in FAA and paraffin embedded as described (Johansen, D. A. (1940) Plant nzicrotechfZigue (McGraw-Hill Book Co., New York).). Serial sections were taken at 8 ~m on a rotary microtome, attached to glass slides with Mayer's egg albumin (Sigma) solution, and dried on a warming tray (42°C). Sections were stained after removal of the embedding medium in toluidine blue O. The sections were observed under a Leitz (Wetzlar) microscope and images were captured using Optronics DEI 750 digital microscope camera.
Scanning electron microscopy For scanning electron microscopy (SEM) the samples were fixed in 3% glutaraldehyde and processed as described (Venglat, S. P. & Sawhney, V. I~. (1996) Planta 1968, 480-487.). Samples were mounted on aluminum stubs and coated with gold in an Edwards S150B sputter-coater.
Observations were made with a Phillips SEM 505 scanning electron microscope at 30 kV and recorded using Polaroid type 665 P/N. Images were scanned and enhanced using Adobe Photoshop 4Ø
Architectural Changes in the infloresence of by mutants. In all by plants the earliest signs of alteration of the inflorescence are evident at the time of bolting, with more compactly arranged floral buds at the apex; the effects were more pronounced when the first few co-florescence internodes from the rosette leaves started elongating. At maturity, by plants display a marked reduction in overall height, primarily as a result of shortened internodes; moreover, the floral internodes were affected to a greater extent than the co-florescence internodes (Fig. 1,2). Additionally, bending at nodes was observed and this phenotype was more severe in bp-1 than bp-2 plants. bp-2 in RLD (the original isolate) and Col backgrounds showed similar patterns, although the reduction in internodal lengths was less than observed in Ler background. by affects cell division and cell differentiation in the internodes of the inflorescence. SEM analysis showed that the floral buds began pointing downwards quite early in their development and that the internodal elongation is significantly reduced. The peduncle surface showed stripes consisting of cell files (~15 cells in width) with changes in epidermal cell differentiation (defined by alterations in by lines in cell size, shape, and/or cell type (stomata) in relation to similar regions in wt) associated with regions below the nodes (Fig. 3). Cross sections through internodes in by indicated that the overall radial pattern, in terms of tissue types, was very similar to the wt (Fig. 3). However, small sectors with changes in epidermal cell differentiation are observed, and these corresponded to the stripes of differentiation-altered cells observed by SEM. Furthermore, the cortical cells below these sectors Were had changes in differentiation (indicated by a lack of chloroplasts), and the cells were relatively larger with less intercellular space.
Longitudinal sections through the nodes showed sectors of epidermal and sub-epidermal changes. As the cell number per unit area along the main axis of the peduncle in BP was comparable to the wt, the reduced internodal length was interpreted to be .a result of fewer cell divisions.
BP causes changes in inflorescence development. Pedicels in by plants at all the floral nodes showed a drastic reduction in length compared with wt (Fig. 2), in addition to downward-pointing siliques (Fig. 1). The degree of the latter phenotype conferred by bp-2 varied in different backgrounds from downward pointing (Ler) to less acute bending in RLD and Col backgrounds. Since very little is known about pedicel development in any plant species, including Af~abidopsis, we determined its ontogeny in Ler wt compared with bp. Pedicel initiation was first observed around stage 3 flowers, followed by elaboration of the pedicel with coordinated development on both the abaxial and adaxial sides, and along the proximo-distal axis. The first signs of epidermal differentiation (defined by characteristic changes in cell shape and the appearance of stomata) were observed on the abaxial side at stage 9, and this was closely followed by differentiation on the adaxial side in subsequent stages. By stage 12 epidermal cell differentiation was completed with no apparent differences observed between the abaxial and adaxial sides in the wt (Fig. 4). In bp, no detectable differences from wt were observed up to stage 3. However, the pedicel differentiation and elaboration processes lagged behind the wt and the first sign of epidermal cell differentiation was observed only at stage 12, and this was restricted to the adaxial surface; no corresponding differentiation was observed' on the abaxial side, even by the mature stage (Fig. 4). Anatomical analysis showed that while the major part of the pedicel in by contained defects in the differentiation of abaxial-side epidermal cells and cortical cells (Fig. 4), the distal region including the receptacle was more strongly affected with a significantly reduced pith region, cell size and differentiation, and radial growth (Fig. 4). Longitudinal sections through the pedicels also showed that the cells in the epidermal layer and cortical tissues on the abaxial side were less elongated (Fig. 3). Furthermore, there were fewer cells in the proximo-distal axis of the pedicel, indicative of fewer cell divisions. Although there were no apparent defects observed in the sepals, petals, and stamens, the carpels showed detectable differences in bp. Notably, there was reduced radial growth of the style (Fig. 5), although there was variability observed between plants regarding this phenotype. The epidermal and cortical cells of the style, especially in the lateral axis, were defective in differentiation and elongation, and as a consequence the arrangement of stigmatic papillae was significantly altered (Fig. 5). These observations support a functional role for BP in maintaining the normal growth and radial symmetry of the style. The developmental and anatomical studies suggested that the defects in by were only associated with the peduncle and parts of the flower but not with the leaves.
Example 2: Isolation of the KNATI coding sequence.
To isolate the KNATI coding sequence, cDNA cloning was used.
Reverse transcription was carried out using 3-5 ~.g of total RNA from stem tissue of wt (Col, Ler, RLD) and by plants and Superscript II RT (Life Technologies). To amplify the KNATl open reading frame (ORF), 1 ~1 of cDNA
was used for PCR with primers Seq ID NO: 1 954 DNA SEQ 5' cgggatccatggaagaataccagcatgac 3' and SEQ Id NO: 2 .20 955 DNA SEQ 5' cgggatccggtacctggatgtcttatggaccgag 3' and Pfu polymerase (1U). Amplification of the cytosolic glyceraldehyde-3-phosphate dehydrogenase (gapC) cDNA (Shih, M.-C., Heinrich, P. C. ~
Goodman, H. M. (1991) Gefae 104, 133-138.) from the same cDNA pools was performed under the same conditions Seq ID NO: 3 DNA SEQ gapC-UP 5' accactaactgccttgctc 3' 5 and SEQ ID NO: 4 DNA SEQ gapC-DN 5' caatttcacaaacttgtcgctc 3' IO
I~NAT1-encoding PCR products were cloned and sequenced by primer walking using an ABI 377 DNA sequencer. The sequence of the wt KNATl gene is shown in Seq ID NO: 5.
15 Example 3: Expression of BP genes.
Based on the discovery that BP represents the previously described KNAT1 gene, probes for KNAT1 were generated as described above and used to analyzed BP transcript levels in col wt and Ler wt by northern blots and by 20 the more sensitive RT-PCR. Results from these experiments showed 2-4 times higher transcript levels in col wt ecotype (data not shown).
Example 4: Isolation of BP genomic regions.
25 The BP appears to be expressed predominantly in stem and pedicel tissues in wt plants. To clone BP, a region between I~ETI and the centromere on chromosome 4 was chosen, based on genetic maps compiled from several data sets (http:llwww.Ar-abidopsis.org; (Pepper, A., Delaney, T., Washburn, T., Poole, D. & Chory, J. ( 1994) Cell 78.)). To produce probes reflecting the anticipated expression pattern of BP, polyA + RNA was isolated from both stem/pedicel and leaf tissues in Col wt plants and a Suppression subtractive hybridization (SSH) was performed using leaf cDNA as driver. Total RNA was harvested from stem/pedicel and leaf tissues of Col wt using Trizol Reagent (Life Technologies). Poly A + RNA was isolated using mRNA spin columns (Clontech). cDNA synthesis was carried out using a cDNA synthesis kit (Life Technologies). A total of 2 ~g each of leaf cDNA (driver) and stem/pedicel cDNA (tester) was digested with HaeIII (New England Biolabs) and used for suppression subtractive hybridization as described (Diatchenko, L., et al. (1996) Proc. Natl. Acad. Sci. USA 93, 6025-6030.). The subtracted mix was 32 P-labeled using a RediPrime kit (AP Biotech) and used to screen Bacterial Artificial Chromosome (BAC) DNA preparations as described below.
BAC clones from chromosome 4 were obtained from the ABRC. DNA
was prepared from 10-ml cultures of BACs T17A2, T13D4, F9M13, T12G3, T28D5, TISF16, T3F12, T32A17, T3H13, F23J3, T8A17, T30A10, T1~G18, T25P22, and T24H23 using an alkaline lysis miniprep method (Ausubel, F. M., Brent, R., Kingston, R. E., Moore, D. D., Seidman, J. G., Smit, J. A. &
Struhl, K. (1995), (John Wiley and Sons, Inc., New York).). BAC DNA was digested with BamHI, EcoRI, or HindIII (Life Technologies), fractionated on a 0.8%
agarose gel, then blotted to a Zeta Probe membrane (BioRad) using standard procedures as described (Ausubel, et al, ibid.) The blot was probed with the pooled subtracted mix representing cDNAs expressed in stem/pedicel tissue, prepared as described above. Genomic DNA (5 fig) isolated from leaves (Dellaporta, S. (1994) in The Maize HafZdboolc, eds. Freeling, M. & Walbot, V.
(Springer-Verlag, New York), pp. 522-525.) of wt and by plants was digested using 30 U BanaHI or EcoRI (Life Technologies) at 37°C for 8 hours, processed as above, and probed with the 32 P-labeled KNATI RT-PCR product from Col wt. Hybridization proceeded for 3 h (BAC screen) or overnight (genomic Southern blot) at 65°C in QuickHyb hybridization solution (Stratagene); the most stringent wash was in O.lx SSC/0.1% SDS at 65°C. The blots were exposed to X-GMAT AR film (Kodak) overnight at -70°C. PCR, RT-PCR, and DNA sequencing.
The pooled subtracted products were then used as a probe in a Southern blot with 15 BACs as targets spanning a region of approximately 1.5 Mb on chromosome 4 between Z)ETI and the centromere. A BamHI fragment of about kb from BAC F9M13 was the only band that showed any hybridization to the 15 subtracted probe. BAC F9M13 (GenBank AC006267) contains a single gene on this 20-kb BamHI fragment within a region rich in repeats. Subsequent fingerprinting of F9M13 with this probe confirmed that the probe detected the previously reported homeobox gene KNATl.
20 Example 5: Determination of BP gene coding sequence in by mutant and wild type lines.
It was found that the bp-1 mutant represented a deletion of the BP gene.
To identify the molecular basis for the bp-2 mutant phenotype, BP-encoding RT-PCR products from duplicate reverse transcription reactions using L. er (wt), RLD (wt), bp-2 (col), bp-2 (Ler), and bp-2 (RLD) were then cloned and their sequences determined. It was found that the bp-2 lines contained an altered protein coding sequence which has a C-T transition corresponding to position 535 of the col (wt) ORF. This is shown in SEQ ID NO: 6, the bp-2 coding region. This point mutation changed codon 179 from cag to tag, thereby introducing a stop codon and resulting in a truncated predicted protein sequence shown in SEQ ID NO: 7.
This sequence analysis further demonstrated that in wt Ler and RLD the BP
ORFs encoded predicted proteins of 400 aa, compared with a predicted protein of 398 as for col wt.
Example 6: Complementation of by mutant lines In order to demonstrate the function of the ~KNATI gene in the by phenotype, plants exhibiting a by phenotype were transformed with a wild-type 1 S KNATI gene under the control of the native BP (KNATI ) promoter. Two different complementation constructs were prepared. The structure of the vectors used for complementation of the by phenotype in Ai°abidopsis thaliana is as follows:
The backbone for both vectors was pRD400 (Datla, R. S. S., J. K.
Hammerlindl, B. Panchuk, L. E. Pelcher, and W. Kelley. 1992. Modified binary plant transformation vectors with the wild-type gene encoding NPTII. Gene 122:383-384). This vector was used to derive two plant transformation vectors.
In both constructs, the BamHI sites at the junction of the promoter and ORF
were introduced to facilitate assembly of the constructs. B, BanZHI; Bg, BgIII, K, KpnI. Parentheses indicate sites destroyed by ligation.
Construct A. Referred to as pRD400-951/955, consisting of the KNATl cDNA (SEQ ID NO: 5) cloned downstream of the putative KNATl promoter as shown in figure 8. The KNATI promoter was isolated by PCR using the .
following primers:
SEQ ID NO: 8 5'cccaagcttagatctttcggtctagtgcagtgatg 3' and Sequence ID NO: 9 5' ccggatcccagatgagtaaagatttg 3' for amplification of the putative KNATI promoter; 1536 by product corresponding to the region immediately upstream of the KNATI start codon.
Amplification conditions for all primers using genomic DNA as template were as follows: 94°C, 2 min followed by 30 cycles of 94°C, 15 sec;
55°C, 30 sec;
and 72°C, 4-6 min. A final extension of 10 min at 72°C was performed. All amplifications from genomic DNA used Pfu polymerase (Stratagene) (2.5 U) and a PTC-200 thermal cycler (MJ Research).
Construct B. Referred to as pRD400-951/956, consisting of the putative KNATl promoter and the KNATI -encoding ORF amplified from genomic DNA.
To amplify the KlVATl coding region, two primers were used, Seq ID NO: 1 (as described in example 2), and SEQ ID NO: 10 IO . 5' gaagatctgtcgacgccttgtgcttgattgagactcca 3' for amplification of the protein coding region and terminator from genomic DNA; 3347-by product from the KNATl start codon to a point 705 by downstream of the stop codon, including the putative transcriptional terminator.
Agrobacteriurrz tunZefaciefzs GV3101 containing these recombinant constructs were used to transform bp-2 (Ler) plants by vacuum infiltration (Bechtold, N., Ellis, J. & Pelletier, G. (1993) C.R. Aead. Sei. Ser. 11I316, 1199.). Transformation of bp-2 (Ler) with the genomic clone of KNATI resulted in 20 transformants; 4 were completely rescued to wt, while the others were partially rescued. Southern analysis confirmed that these complemented lines contained the KNATI wt transgene. Further analysis of two of these single transgene copy lines showed a 3:1 (wt:bp) segregation pattern in the T2 generation, providing genetic confirmation of complementation.
Complementation of BP with KNATI cDNA was also observed.
Example 7: Overexpression of the Arabidopsis BP gene.
In this example, the native Arabidopsis BP gene (wt K1VAT1 ) was used for over expression. The BP gene coding region (SEQ ID. NO: 5) was used to make an over expression construct with enhanced 35S promoter referred to as pRD400-35S::AtbpS, consisting of the A. thaliana BP ORF under the control of the 35S promoter assembled using routine methods. This vector is shown in Figure 10. The vector was used to transform Arabidopsis as above.
Example 8: Expression of the Arabidopsis BP gene in heterologous species The vector pRD400-35S::AtBPS was used to transform B. napus. The vector was inserted into Agrobacterimn stain MP90 by standard triparental mating followed by Ags°obacteriunz-mediated transformation of Brassica.
Transformation was essentially carried out as described by Moloney et al., Plant Cell Reports 8:238-242, 1989.
Example 9: Construction of antisense Arabidopsis BP genes The BP coding region was used to construct an antisense construct under its own promoter (l.Skb) and also the 35S promoter. For expression of antisense RNA under the 35S promoter, the vector pRD400-35S::AtBPA/S, consisting of the A. thaliana by ORF in an antisense orientation under the control of the promoter was constructed and is shown in Figure 11.
For expression of antisense RNA under the KNATI promoter, the vector pRD400-951 /952::AtbpA/S, consisting of the A. thaliana by cDNA (nucleotides 481-1227) in an antisense orientation under the control of the A. thaliana KNATl promoter was constructed and is shown in Figure 12.
Teens used: Nos Ter, Nos terminator. B, Baf~zHI; Bg, BgIII, I~, KpfZI; H, HirzdIII, S, SstI.
Example 10: Expression of an altered Arabidopsis BP gene In this example, the protein encoded by SEQ ID NO: 6 was expressed under its own promoter (l.Skb) and also the 35S promoter.
For expression of the altered BP gene under the 35S promoter, the vector pRD400-35S::Atbp-2, consisting of the A. thaliana bp-2 ORF under the control of the 35S promoter is constructed using the same procedures as for the wild-I S type coding sequence and is shown in Figure 12.
For expression of the altered BP gene under the KNATI promoter, the vector pRD400-951/952::Atbp-2, consisting of the A. thaliana bp-~ cDNA
(nucleotides 481-1227) in an antisense orientation under the control of the A.
tJZaliana KNATI promoter is constructed as above and is shown in Figure 13.
Example 11: Isolation of BP related coding sequences from other species: B.
yiapus The A. thalia~za KNATl (BP) cDNA isolated in example 2 was used to screen a cDNA library prepared from stem tissues of B. ~capus. A total of 200,000 pfu were initially screened under moderate stringency hybridization conditions (hybridization solution contained 30% fonnamide/5x SSC/5x Denhardt's solution/0.5% SDS/50 ~g/mI salmon sperm DNA at 42°C, with final washes in O.lx SSC/0.1% SDS at 55°C). 13 plaques were purified from these primary screens; these were excised from their phagemid hosts and sequenced.
BLAST analysis showed that the clones fell into 3 groups: nonspecific I O clones (discarded); homeobox gene-Like sequences that were not likely orthologs ofA. thaliana Knatl; and apparent Knatl orthologs. The latter group was represented xhe most frequent and consisted of both full-length and 5' truncated clones. The complete sequence on both strands was determined for the longest cDNA isolated from these screens (1515 bp), which was designated the name Bnbp.
This cDNA contained an ORF of 1158 by with 73 nucleotides of 5' untranslated region (UTR) and 284 nucleotides of 3' UTR and is shown in SEQ
ID NO: 11. The predicted protein encoded by this cDNA was 385 amino acids in length and showed 86.3% similarity (PAM250 residue weight table) to A.
thaliana bp.
PCR primers SEQ ID NO: 12: 5'-cgggatccatggaagaatatcaacatgaa-3' SEQ ID NO: 13: 5'-cgggatccggtaccttatggtccaagacgat-3' were designed to amplify the ORF from this cDNA with ends modified with Bdn2HIlNcoI (5' end) and BarnHIlKpnI (3' end) to facilitate its insertion into the expression constructs described above. The Bnbp ORF was amplified from the cDNA isolated from the library screens with Pfu polymerase (Stratagene) and cloned into a standard PCR product cloning vector (pCR2.l;
Invitrogen).
Example 12: Isolation of BP related coding sequences from other species: B.
papa, B. olenacea The PCR primers that were designed to amplify the Bnbp ORF were used to isolate by orthologs from species closely related to B. faapus. Total RNA
was extracted from B. s°apa and B. oleracea (kale) hypocotyls harvested 6 days after germination and used as a template for first strand cDNA synthesis with Superscript II reverse transcriptase (Life Technologies). This eDNA was then used as a PCR template to amplify bp-like cDNAs from these species. PCR
products were cloned into a standard vector (pCR2.1) and their sequences determined by primer walking. The sequences are shown in Seq ID Nos. 14 and 15.
Example 13: Isolation of BP related genes from other species: B. r~apa, B.
oleracea Isolation of genomic clones encoding BP from B. napus, B. s°apa, and B.
oleracea. Using the sequences of the by cDNAs determined as described above, PCR primers were designed to amplify the genomic copies (including introns) of the BP genes from each species (B. napus, B. f°apa, B. oleracea). The primers 5 used were:
Seq ID NO: 16: PCR Primer used to amplify B. napus BP from genomic DNA
5'-ataacaccaccaccaacaac-3' Seq ID NO: 17: PCR Primer used to amplify B. napus BP from genomic DNA
5'-actaggaagtctcaaacccc-3' Seq ID NO: 18: PCR Primer used to amplify B. rapa, B. oleracea B.P from genomic DNA .
5'-tcaacatgaaagcagatccac-3' Seq ID NO: 19: PCR Primer used to amplify B. f°apa, B. oleracea BP
from genomic DNA
5'-aacgagagaggcaacaaaag-3' The PCR products (approximately 3.8 kb for each species) were cloned into pCR2.1 and their sequences were determined by primer walking.
The sequence of the B. raapus by genomic region isolated using primers as described in Seq ID nos. 16 and 17 is shown in SEQ ID NO: 20 The sequence analysis revealed that the B. napus BP coding region, like that of A. thaliafza BP, is interrupted by 4 introns. The positions and relative lengths of the introns were all similar to the A. thaliana BP gene.
Example 14: Isolation of BP promoter regions from B. napus Isolation of sequences upstream of B. fzapus BP, including the probable promoter. The sequence of the BP-encoding cDNA from B. hapus was used to design primers to isolate 5' regions of the by gene. Primers used were:
SEQ ID NO: 21: PCR Primer used to amplify the region upstream of the by gene from B. aapus 5'-catgatcggatcggaagcaattctcagtcg-3' SEQ ID NO: 22: PCR Primer used to amplify the region upstream of the by gene from B. hapus 5'-aaaagttgagagagaaagagagagagagag-3' to isolate the putative promoter-containing region from genomic DNA.
For this purpose, a Genome Walker kit (Clontech) was used. Following the standard protocols in the kit, two fragments (840 and 950 bp) were isolated that represent the likely promoters of the two BP genes of B. napus. The sequences are presented in SEQ ID Nos. 23 and 24.
Example 15: Construction of a vector comprising the Br~assica BP gene under the control of an A~~abidopsis promoter.
The map of the vector of pRD400-951 /952::BnBPS, consisting of the B.
napus BP ORF (SEQ ID. NO: 11 ) under the control of the A. thaliana KNATI
promoter constructed using standard techniques is shown in figure 14. The vector was used to transform Arabidopsis and Brassica napus as described.
Example 16: Construction of a vector comprising the Bnassica BP gene under the control of a constitutive promoter.
The vector map of pRD400-35S::BnBPS, consisting of the B. napus BP
ORF (Seq ID NO: 11) under the control of an optimized cauliflower mosaic virus (CaMV) 35S promoter (Datla, R. S. S., F. Bekkaoui, J. K. Hammerlindl, G. Pilate, D. I. Dunstan, and W. L. Crosby. 1993. Improved high-level constitutive foreign gene expression in plants using an AMV RNA4 untranslated leader sequence. Plant Sci. 94:139-149) is shown in figure 15. The vector was assembled using well-known techniques as described. The vector was used to transform Arabidopsis and Bf-assica rZapus as described herein.
Example I7: Construction of a vector comprising a B~~assica antisense BP
gene under the control of a constitutive promoter.
The vector map pRD400-35S::BnbpA/S, consisting of the B. napes BP
ORF in an antisense orientation under the control of the 35S promoter is shown in figure 16. The vector was assembled using well-known techniques as described. The vector was used to transform A~abidopsis and Brassica napes as described herein.
Sequence listing free text SEQ ID NO: 1 954 DNA SEQ - PCR primer SEQ ID NO: 2 955 DNA SEQ - PCR primer SEQ ID NO: DNA SEQ gapC-UP - PCR primer SEQ ID NO: 4 DNA SEQ gapC-DN .
SEQ ID NO: 8 DNA SEQ 951 - PCR primer SEQ ID NO: 9 DNA SEQ 952 - PCR primer SEQ ID NO: 10 DNA SEQ 956 - PCR primer SEQ ID NO: PCR primer SEQ ID NO: 13 PCR primer SEQ ID NO: 16 PCR primer SEQ ID NO: 17 PCR primer SEQ ID NO: 18 PCR primer SEQ ID NO: PCR primer SEQ ID NO: 21 PCR primer SEQ ID NO: 22 PCR primer Sequence ID listing Seq ID NO: 1 954 DNA SEQ (Synthetic DNA) 5' cgggatccatggaagaataccagcatgac 3' SEQ Id NO: 2 955 DNA SEQ (Synthetic DNA) 5' cgggatccggtacctggatgtcttatggaccgag 3' Seq ID NO: 3 DNA SEQ gapC-UP (Synthetic DNA) 5' accactaactgccttgctc 3' SEQ ID NO: 4 DNA SEQ gapC-DN (Synthetic DNA) 5' caatttcacaaacttgtcgctc 3' 15' Seq ID NO: 5 KNAT 1 gene (cDNA Sequence) 5'cgggatccatggaagaataccagcatgacaacagcaccactcctcaaagagtaagtttcttgtactctccaatct cttcttccaacaaaaacgataacacaagtgataccaacaacaacaacaacaataataatagtagcaattatggtcct ggttacaataatactaacaacaacaatcatcaccaccaacacatgttgtttccacatatgagctctcttctccctcaaa c aaccgagaattgcttccgatctgatcatgatcaacccaacaacaacaacaacccatctgttaaatctgaagctagctc ctcaagaatcaatcattactccatgttaatgagagccatccacaatactcaagaagctaacaacaacaacaatgaca acgtaagcgatgttgaagccatgaaggctaaaatcattgctcatcctcactactctaccctcctacaagcttacttgga ctgccaaaagattggagctccacctgatgtggttgatagaattacggcggcacggcaagactttgaggctcgacaa cagcggtcaacaccgtctgtctctgcctcctctagagacccggagttagatcaattcatggaagcatactgtgacat gttggttaaatatcgtgaggagctaacaaggcccattcaggaagcaatggagtttatacgtcgtattgaatctcagctt agcatgttgtgtcagagtcccattcacatcctcaacaatcctgatgggaagagtgacaatatgggatcatcagacga agaacaagagaataacagcggaggggaaacagaattaccggaaatagacccgagggccgaagatcgggaact caagaaccatttgctgaagaagtatagtggatacttaagcagtttgaagcaagaactatccaagaagaaaaagaaa ggtaaacttcctaaagaagcacggcagaagcttctcacgtggtgggagttgcattacaagtggccatatccttctga gtcagagaaggtagcgttggcggaatcaacggggttagatcagaaacaaatcaacaattggttcataaaccaaag aaagcgtcactggaaaccatctgaagacatgcagttcatggtgatggatggtctgcagcacccgcaccacgcagc tctgtacatggatggtcattacatgggtgatggaccttatcgtctcggtccataagacatccaggtaccggatcccg 3' SEQ ID NO: 6, the bp-2 coding region (cDNA Sequence) 5'cgggatccatggaagaataccagcatgacaacagctccactcctcaaagagtaagtttcttgtactctccaatctc ttcttccaacaaaaacgataacacaagtgataccaacaacaacaacaacaataataatagtagcaattatggtcctg gttacaataatactaacaacaacaatcatcaccaccaacacatgttgtttccacatatgagctctcttctccctcaaac a accgagaattgcttccgatccgatcatgatcaacccaacaacaacccatctgttaaatctgaagctagctcctcaag aatcaatcattactccatgttaatgagagccatccacaatactcaagaagctaacaacaacaacaatgataacgtaa gcgatgttgaagccatgaaggctaaaatcattgctcatcctcactactctaccctcctacaagcttacttggactgcca aaagattggagctccacctgacgtggttgatagaattacggcggcacggcaagactttgaggctcgacaatagcg gtcaacaccgtctgtctctgcctcctctagagacccggagttagatcaattcatggaagcatactgtgacatgttggtt aaatatcgtgaggagctaacaaggcccattcaggaagcaatggagtttatacgtcgtattgaatctcagcttagcatg ttgtgtcagagtcccattcacatcctcaacaatcctgatgggaagagtgacaatatgggatcatcagacgaagaaca agagaataacagcggaggggaaacagaattaccggaaatagacccgagggccgaagatcgggaactcaagaa ccatttgctgaagaagtatagtggatacttaagcagtttgaagcaagaactatccaagaagaaaaagaaaggtaaa cttcctaaagaagcacggcagaagcttctcacgtggtgggagttgcattacaagtggccatatccttctgagtcaga gaaggtagcgttggcggaatcaacggggttagatcagaaacaaatcaacaattggttcataaaccaaagaaagcg tcactggaaaccatctgaagacatgcagttcatggtgatggatggtctgcagcacccgcaccacgcagctctgtac atggatggtcattacatgggtgatggaccttatcgtctcggtccataagacatccaggtaccggatcccg 3' SEQ ID NO: 7predicted bp-2 protein (Protein Sequence).
MEEYQHDNSSTPQRVSFLYSPISSSNKNDNTSDT SSNYGPG
YNNTNNNNHHHQHMLFPHMSSLLPQTTENCFRSDHDQPNNNPSVI~SEA
SSSRINHYSMLMRAIHNTQEANN~NNNDNVSDVEAMKAI~IIAHPHYSTLL
QAYLDCQI~IGAPPDVVDRITAARQDFEARQ*
SEQ ID NO: 8DNA SEQ 951 (Synthetic DNA) 5'cccaagcttagatctttcggtctagtgcagtgatg 3' Sequence ID NO: 9. ~ DNA SEQ 952 (Synthetic DNA) 5' ccggatcccagatgagtaaagatttg 3' SEQ ID NO: 10 DNA SEQ 956 (Synthetic DNA) 5' gaagatctgtcgacgccttgtgcttgattgagactcca 3' SEQ ID.NO: 11:, B. napus by gene(BnBP) (cDNA Sequence) 5'ggcacgagcacattagttttttatattctctctctctctctctctttctctctcaacttttattcatctgggtatgg aagaat atcaacatgaaagcagatccactcctcatagagtaagtttcttgtactctccaatctcttcttccaacaaaaatgataa c accaccaccaacaacaataataccaattatggttctggttacaataatactaataacaataatcatcaacaacacatgt , .
tgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccgatcatgatcagcctaccaacgc atctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaagccatccacaatactcaaga aactaacaacaacaacaatgatacggaatccatgaaagctaagatcatcgctcatccccactactccaccctcctac acgcctacttggactgccagaagattggagcaccacctgaggtggtcgataaaattacggcggcaagacaagagt tcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctagagacccggaattggatcaattcatg gaagcatactgtgatatgctggttaaatatcgagaggagctaacacggcccattgaagaagcaatggagtatatac gtcgtattgaatctcaaattagcatgttgtgtcagggtcccattcacatcctcaacaatcctgatgggaaaagtgaag gaatagaatcatcagacgaagagcaagataataacaacagtggaggggaagcagaattaccggaaatagaccc gagggcggaagatcgggaactcaagaatcacttgctgaagaagtacagtggatacttgagcagtctaaagcaag aactgtccaagaaaaaaaagaaaggtaaacttcccaaagaagcaaggcagaagcttctcacgtggtgggaattgc attacaagtggccgtatccttctgaatcagagaaggtggcgttggcggaatcaacggggttagatcagaaacagat caacaattggttcataaaccaaagaaaacgtcactggaaaccgtccgaggacatgcagttcatggtgatggatggt ctacagcacccgcaccacgcagctctatacatggatggtcattacatgggcgatggtccttatcgtcttggaccata agagaccacatgcagatatccagaagggttagccatataataacaaccttttgttgcctctctcgtttacagttcatga t ttcaactttccttcacaagtttgctacctatagctttattttcttacccgtatttaatgtcttatatcgttcaaggggt ttgaga cttcctagtcattttcactttttattttgtatttttcataatgttttatttataa tatgtgttctaataatgtgtgaaaagagatgttt ttatgaattttaaaaaaaaaaaaaaaaaaaa 3' SEQ ID NO: 12: PCR Primer (Synthetic DNA) 5'-cgggatccatggaagaatatcaacatgaa-3' SEQ ID NO: 13: PCR Primer (Synthetic DNA) 5'-cgggatccggtaccttatggtccaagacgat-3' Seq ID NO: 14: B. raga by gene (cDNA Sequence) 5'cgggatccatggaagaatatcaacatgaaagcagatccactcctcatagagtaagtttcttgtactctccaatctct tcttccaacaaaaatgataacaccaccaccaacaacaataataccaattatggttctggttacaataatactaataaca ataatcatcaacaacacatgttgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccga t catgatcagccaaccaacgcatctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaa gccatccacaatactcaagaagctaacaacaacaacaacaacaaygatatggaatccatgaaagctaagatcatc gctcatcctcactactccaccctcctacacgcctacttggactgccagaagattggagcaccacctgaagtggttga taaaattacggcggcaagacaagaattcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtcta gagaccccgaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgagaggagctaacacggcc ~
cattgaagaagcaatggagtatatacgtcgtattgaatctcagattagcatgttgtgtcagggtcccattcacatcctc aacaatcctgatgggaaaagtgaaggaatggaatcatcagacgaagagcaagataataacaacagtggagggg aagcagaattaccggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaaatacagt ggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcccaaagaagcaaggca gaagcttctcacgtggtgggaattgcattacaagtggccgtatccttctgaatcagagaaggtggcgttggcggaat caacggggttagatcagaaacagatcaacaattggttcataaaccaaagaaaacgtcactggaaaccgtccgarg acatgcagttcatggtgatggatggtctacagcacccgcaccacgcagctctatacatggatggtcattacatgggc gatggcccttatcgtcttggaccataaggtaccggatcccg3' SEQ ID NO: 15: B. Oleracea by gene (cDNA Sequence) 5'cgggatccatggaagaatatcaacatgaaagcagatccactcctcatagagtaagtttcttgtactctccaatctct tcttccaacaaaaatgataacaccaccaccaacaacaataataccaattatggttctggttacaataatactaataaca ataatcatcaacaacacatgttgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccga t catgatcagcctaccaacgcatctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaa gccatccacaatactcaagaaactaacaacaacaacaatgatacggaatccatgaaagctaagatcatcgctcafc cccactactccaccctcctacacgcctacttggactgccagaagattggagcaccacctgaggtggtcgataaaatt acggcggcaagacaagagttcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctagagac ccggaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgagaggagctaacacggcccattga agaagcaatggagtatatacgtcgtattgaatctcaaattagcatgttgtgtcagggtcccattcacatcctcaacaat cctgatgggaaaagtgaaggaatagaatcatcagacgaagagcaagataataacaacagtggaggggaagcag aattaccggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaagtacagtggatact tgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcccaaagaagcaaggcagaagctt ctcacgtggtgggaattgcattacaagtggccgtatccttctgaatcagagaaggtggcgttggcggaatcaacgg ggttagatcaaaaacagatcaacaattggttcataaaccaaagaaaacgtcactggaaaccgtccgaggacatgc agttcatggngatggatggtctacagcacccgcaccacgcagctctatacatggatggtcattacatgggcgatgg tccttatcgtcttggaccataaggtaccggatcccg3' Seq ID NO: 16: PCR Primer (Synthetic DNA) S'-ataacaccaccaccaacaac-3' Seq ID NO: 17: PCR Primer (Synthetic DNA) 5'-actaggaagtctcaaacccc-3' Seq ID NO: 18: PCR Primer (Synthetic DNA) 5'-tcaacatgaaagcagatccac-3' Seq ID NO: 19: PCR Primer (Synthetic DNA) 5'-aacgagagaggcaacaaaag-3' Seq ID NO: 20: B. napus BP genomic fragment (Genomic DNA) 5'ataacaccaccaccaacaacaataataccaattatggttctggttacaataatactaataacaataatcatcaacaa cacatgttgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccgatcatgatcagccaa c caacgcatctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaagccatccacaatac tcaagaagctaacaacaacaacaacaacaatgatatggaatceatgaaagctaagatcatcgctcatccgcactac tccaccctcctacacgcctacttggactgccagaaggttatatagatttagcactggatttcgttttatttttgttgta gta atatataaaataccactcttgtttgtttaaattaacgagatgatatgcgtaaatatgttcacgggttgcatatacagat tg gagcaccacctgaagtggttgataaaattacggcggcaacacaagagttcgaggcgaggcagcagcggccaac agcatccgtaactgcgctgtctagagaccccgaattggatcaattcatggtaaattaattatcaaactgaattatagtg ggtcgtttcttcaagtgtatatgttaagtctttatttttgtttgtatcgtaaattttatcaacaggaagcatactgtga tatgct , ggttaaatatcgagaggagctaacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcagatta gcatgttgtgtcagggtcccattcacatcctcaacaatcctggtaaatgtcataaaactcacaaatacatatacatgea tatacccacatgtaaccattgaatgtagaaaagaaaatataatgccaaggtagggctcatgatgaatttcaagagca acattggcgcgtatttctttggttcccgggaaagttttgtaccaattagattatgataaggcgaccaaaaaataattat g attatatttggttaaaatttttcatctaaacattcaagtgttaattaagatcataaaa~ataatagttaatatgataga aattc gtaggctgcagacagatgtgcacatttgctcttgttttccctattgtagaatccatccaaagagggtggggcttttttt g gtttcttacttttaacccggcccaaagtactactgtcacaaacactttttgttgttcactatgaaaaaaaatacaaata gg tattctcaattccagtatgcaaaatgtttcaaattttcataaaaaagtcagtacgactaaattgctcgtgaattatgaa tca aaatataagactgatgaaaagctaaaatttgaaacagatgggaaaagtgaaggaatggaatcatcagacgaagag caagataataacaacagtggaggggaagcagaaattaccggaaatagacccggagggcggaagatcgggaac tcaagaatcacttgctgaagaagtacagtggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaa aggtaaacttcccaaagaagcaaggcagaagcttctcacgtggtgggaattgcattacaagtggccgtatccttctg tacgtataattttactctcatctctctatgctttcagtcttttaaaatatacactctatataaatactagaaccagtct tttgga aaacaatgtagatgctgggaatctccaatttgccctgattttctctaaagggccttccttaggccgattaggctctttg c agggatcatttgtagatgctaggctctttgcagagataatttgtgttcaaacctttatgcgtttccatatttcataaca tat gtatatatacatatatcaaacacgtttttatctatagttatctaaattttgaaataattttgaagtttaagtccgtgga tctatt gttatagtttatcagcttcaggaaataaaacaaataaaaccgaatgtggtgatggcgaaggtctttaatattgggtata catatttaccacaaaaaaaatgatatattatatagaatggctgtttgttgttaaaaaatcctggtattttttttggtaa atatg ataccatttccaatgaacaccaaaaatgataccatcccaccaaatttgttgtaatgtaaaaagtattacaccaaattaa c aatattcattacaccaaatattaaaataatatattttattattttttatttaataatagatagattagttttttactta gttataact tatagttaaaatgagtatatcataatatcttgtatttttaatccatatttttacattactaaaacattaaactattatt ttattttat aatttaattaatagtatataattaaatgagtattataaattatattaaatggtaacaaaataaaaatgatcttcatttt aaatg caaaaagttttaatttttacaaatattttaaataaaataaataataaagtatacacattmactaaaagaaaaatagctt at ataaaaataaaattaccaaatattaatatatatatatatatatatataaactaaatgtgatacatatatataattagtc aatta taaacaattaatgtattaaattactaaaactaaaaagttgataatataaaatattattttggtgtagaatttggtgtga tggt tggacatgaaaaataaagtttaacmcttaaacmccmmtyctggtgtaatttcarcactaattttagtgttatggttgg agataccctaacagaaccatgcttcgtgctttgaaaaaaaaatcagtcgtctaaagctacaataaaaaaattggagg gaaatattttgtttcaaattaggttatgtatttacacagatatttgtttggattcttgtctgagaagtgcatggcatta catttt gtgttacaaaagaagttgaatgatctgagtatcatatttattgaaagcgtgttggtatatgtgtgttgctaaaaagttc tat aagaaaattggataaatttgctttaaaatttccatagtatatcactattttgtatgttcggaaaccttgatatgtatac ttttc ccttataacgagggccttaatattctttagtcatctagattgttcgaagcagcagactgtaatttataacttcgtctga cta tcatctaccttttttatagaacataccttttcttttattgaaactaatatcgtctagcttttgtgattaaatctaccgt ttttaaac aatgaacaatactaaaaaagtgatgatatggatatggttctgatttgtgttgtgtggcaggagtcagagaaggtggcg ttggcggaatccaacggggttagatcagaaacagatcaacaattggttcataaaccaaagaaaacgtcactggaaa ccgtccgaagacatgcagttcatggtgatggatggtctacagcacccgcaccacgcagctctatacatggatggtc attacatgggcgatggtccttatcgtcttggaccataagagaccgcatgcagatatccagaagggttagccatataat aacaaccttttgttgcctctctcgtttacagttcatgatttcaactttccttcacaagtttgctacctatagctttatt ttcttac ccgtatttaatgtcttatatcgttcaaggggtttgagacttcctagt3' 5. SEQ ID NO: 2I : PCR Primer (Synthetic DNA) 5'-catgatcggatcggaagcaattctcagtcg-3' SEQ ID NO: 22: PCR Primer (Synthetic DNA) 5'-aaaagttgagagagaaagagagagagagag-3' IO
SEQ ID NO: 23: BnBP promoter (Bnbppr900) (Genomic DNA) 5'aaaaaatgcttacaaatatctgcacatcaaccaatctgttacataaatagatcttcttgtgggggtagggttaacaa atattttcctctttttcttttctcaaaaatgtatcggtactgatatagccgcggagacctggttcattaaaacattggc ggt acatcttaataatcaaaacattgacggcacatcttaatcctagagtttaaccacattatatatcatagagtaacaaact ta gtttttgacccaaaagaagaaaaaaaacttccaattttctagtacagaataagcctacgagagggaaacagaagag aaaggaggaaagaagggaagcctttgccttatctcttgtccattctctcttacctttatttttaattttcaaatattta ttatt gccaccaaagcaaacgacgtcttgtcaatccactcaacccacccaacttcttaattattgttaacacatctctcctctt t ctctctcatctttttataatttcttctcttccatgtcactttttgacgaattctatttacttagttcgttttttcttcc tcaaaatatc tcgttttcaatttatttgttttgttgggtgcaacttcacctcacaattttttttatgaagcacctttctgattcgtaga tatgagt cgtctagtcatgtggatttgatttggttaaagtctaacatcgacctttgattgaaataaggacaaaagaaagaatacat acatccccttcattttgcacccatccctttattttctagggttttatttttatcacattagttttttatattctctctc tctctctctc tttctctctcaactttt3' SEQ ID NO: 24: BnBP promoter (Bnbppr 1000)(Genomic DNA) 5'aaatctttatcttctctgtttcttgtgcaatcttctatccgaaaacgagtacaatataatctctctccaccgatgta atac gaatatcaaatcagaaattaatcatttgatcatattctcaaaacatctaaatttattttacaaattgcttacaaatatc tgca catcaaccaatctgttacataaatagatcttcttgtaggggtaaggttaacaaatatttttttctttttcttttctcca aaatgt atcggtactgatatagccgcggagacctggttcatcaaaacattgacggtacatcttaattcgagagtttaaccaaatt atatcatagagtaacaaacttagtttttgacccaaaataagagaaaaaactttcaattttctaatacggaataagctat g agagggagacagaagagaaagtaggaaagaagggaagcctttgccttatctcttgtccattctctcttacctttatttt aattttcaaatatttattattgccaccaaagcaaacgacgtcttgtcaatccactcaacccacccaacttcttaattat tgt taacacatctctcctctttctctctcatctttttataatttcttctcttccatgtcactttttgacgaattctatttac ttagttcgtt ttttcttcctcaaaatatctcgttttcaatttatttgttttgttgggtgcaacttcacctcacaattttttttatgaag cacctttc tgattcgtagatatgagtcgtctagtcatgtggatttgatttggttaaagtctaacatcgacctttgattgaaataaga ac aaaagaaagaatacatacatccccttcattttgcacccatccctttattttctagggttttatttttatcacattagtt ttttat attctctctctctctctctctctttctctctcaactttt3' 1./18 SEQUENCE LISTING
<110> NATIONAL RESEARCH COUNCIL OF CANADA
<120> METHODS FOR MODIFICATION OF PLANT INFLORESCENCE
ARCHITECTURE
<130> 47580-PT
<150> US 601281,901 <151> 2001-03-29 <160> 24 <170> Patentln version 3.1 <210> 1 <211> 29 <212> DNA
<213> Artificial sequence <220>
<223> 954 DNA SEQ - PCR primer <400> 1 cgggatccat ggaagaatac cagcatgac 29 <210> 2 <211> 34 <212> DNA
<213> Artificial sequence <22D>
<223> 955 DNA SEQ - PCR primer x/18 <400> 2 cgggatccgg tacctggatg tcttatggac cgag 34 <210> 3 <211> 19 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ gapC-UP - PCR primer <400> 3 accactaact gccttgctc 19 <210> 4 <211> 22 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ gapC-DN
<400> 4 caatttcaca aacttgtcgc tc 22 <210> 5 <211> 1227 <212> DNA
<213> Arabidopsis sp.
<400> 5 cgggatccat ggaagaata'c cagcatgaca acagcaccac tcctcaaaga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa acgataacac aagtgatacc aacaacaaca 120 acaacaataa taatagtagc aattatggtc ctggttacaa taatactaac aacaacaatc 180 atcaccacca acacatgttg tttccacata tgagctctct tctccctcaa acaaccgaga 240 attgcttccg atctgatcat gatcaaccca acaacaacaa caacccatct gttaaatctg 300 aagctagctcctcaagaatcaatcattactccatgttaatgagagccatccacaatactc360 aagaagctaacaacaacaacaatgacaacgtaagcgatgttgaagccatgaaggctaaaa420 tcattgctcatcctcactactctaccctcctacaagcttacttggactgccaaaagattg480 gagctccacctgatgtggttgatagaattacggcggcacggcaagactttgaggctcgac540 aacagcggtcaacaccgtctgtctctgcctcctctagagacccggagttagatcaattca600 tggaagcatactgtgacatgttggttaaatatcgtgaggagctaacaaggcccattcagg660 aagcaatggagtttatacgtcgtattgaatctcagcttagcatgttgtgtcagagtccca720 ttcacatcctcaacaatcctgatgggaagagtgacaatatgggatcatcagacgaagaac780 aagagaataacagcggaggggaaacagaattaccggaaatagacccgagggccgaagatc840 gggaactcaagaaccatttgctgaagaagtatagtggatacttaagcagtttgaagcaag900 aactatccaagaagaaaaagaaaggtaaacttcctaaagaagcacggcagaagcttctca960 cgtggtgggagttgcattacaagtggccatatccttctgagtcagagaaggtagcgttgg1020 cggaatcaacggggttagatcagaaacaaatcaacaattggttcataaaccaaagaaagc1080 gtcactggaaaccatctgaagacatgcagttcatggtgatggatggtctgcagcacccgc1140 accacgcagctctgtacatggatggtcattacatgggtgatggaccttatcgtctcggtc1200 cataagacat ccaggtaccg gatcccg 1227 <210> 6 <211> 1221 <212> DNA
<213> Arabidopsis sp.
<400> 6 cgggatccat ggaagaatac cagcatgaca acagctccac tcctcaaaga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa acgataacac aagtgatacc aacaacaaca 120 acaacaataa taatagtagc aattatggtc ctggttacaa taatactaac aacaacaatc 180 atcaccacca acacatgttg tttccacata tgagctctct tctccctcaa acaaccgaga 240 attgcttccg atccgatcat gatcaaccca acaacaaccc atctgttaaa tctgaagcta 300 , gctcctcaag aatcaatcat tactccatgt taatgagagc catccacaat actcaagaag 360 ctaacaacaa caacaatgat aacgtaagcg atgttgaagc catgaaggct aaaatcattg 420 ctcatcctca ctactctacc ctcctacaag cttacttgga ctgccaaaag attggagctc 480 cacctgacgt ggttgataga attacggcgg cacggcaaga ctttgaggct cgacaatagc 540 ggtcaacacc gtctgtctct gcctcctcta gagacccgga gttagatcaa ttcatggaag 600 catactgtga catgttggtt aaatatcgtg aggagctaac aaggcccatt caggaagcaa 660 tggagtttat acgtcgtatt gaatctcagc ttagcatgtt gtgtcagagt cccattcaca 720 tcctcaacaa tcctgatggg aagagtgaca atatgggatc atcagacgaa gaacaagaga 780 ataacagcgg aggggaaaca gaattaccgg aaatagaccc gagggccgaa gatcgggaac 840 tcaagaacca tttgctgaag aagtatagtg gatacttaag cagtttgaag caagaactat 900 ccaagaagaa aaagaaaggt aaacttccta aagaagcacg gcagaagctt ctcacgtggt 960 gggagttgca ttacaagtgg ccatatcctt ctgagtcaga gaaggtagcg ttggcggaat 1020 caacggggtt agatcagaaa caaatcaaca attggttcat aaaccaaaga aagcgtcact 1080 ggaaaccatc tgaagacatg cagttcatgg tgatggatgg tctgcagcac ccgcaccacg 1140 5/1~
cagctctgta catggatggt cattacatgg gtgatggacc ttatcgtetc ggtccataag 1200 acatccaggt accggatccc g 1221 <210> 7 <211> 176 <212> PRT
<213> Arabidopsis sp.
<400> 7 Met Glu Glu Tyr Gln His Asp Asn Ser Ser Thr Pro Gln Arg Val Ser Phe Leu Tyr Ser Pro Ile Ser Ser Ser Asn Lys Asn Asp Asn Thr Ser Asp Thr Asn Asn Asn Asn Asn Asn Asn Asn Ser Ser Asn Tyr Gly Pro Gly Tyr Asn Asn Thr Asn Asn Asn Asn His His His Gln His Met Leu Phe Pro His Met Ser Ser Leu Leu Pro Gln Thr Thr Glu Asn Cys Phe Arg Ser Asp His Asp Gln Pro Asn Asn Asn Pro Ser Val Lys Ser Glu Ala Ser Ser Ser Arg Ile Asn His Tyr Ser Met Leu Met Arg Ala Ile His Asn Thr Gln Glu Ala Asn Asn Asn Asn Asn Asp Asn Val Ser Asp Val Glu Ala Met Lys Ala Lys Ile Ile Ala His Pro His Tyr Ser Thr Leu Leu Gln Ala Tyr Leu Asp Cys Gln Lys Ile Gly Ala Pro Pro Asp Val Val Asp Arg Ile Thr Ala Ala Arg Gln Asp Phe Glu Ala Arg Gln <210> 8 <211> 35 <2l2> DNA
<2l3> Artificial sequence <220>
<223> DNA SEQ 951 - PCR primer <400> 8 cccaagctta gatctttcgg tctagtgcag tgatg 35 <210> 9 <211> 26 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ 952 - PCR primer <400> 9 ccggatccca gatgagtaaa gatttg 26 <210> 10 <211> 38 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ 956 - PCR primer <400> 10 gaagatctgt cgacgccttg tgcttgattg agactcca 3g <210> 11 <211> 1515 <212> DNA
<213> Brassica napus <400> 11 ggcacgagca cattagtttt ttatattctc tctctctctc tctctttctc tctcaacttt 60 tattcatctg ggtatggaag aatatcaaca tgaaagcaga tccactcctc atagagtaag 120 tttcttgtac tctccaatct cttcttccaa caaaaatgat aacaccacca ccaacaacaa 180 taataccaat tatggttctg gttacaataa tactaataac aataatcatc aacaacacat 240 gttgttccca catatgagct ctcttcttcc tcaaacgact gagaattgct tccgatccga 300 tcatgatcag cctaccaacg catctgttaa atcagaagca agctcctcaa gaatcaatca 360 ctactctatg ttgatgaaag ccatccacaa tactcaagaa actaacaaca acaacaatga 420 tacggaatccatgaaagctaagatcatcgctcatcc~cactactccaccctcctacacgc480 ctacttggactgccagaagattggagcaccacctgaggtggtcgataaaattacggcggc540 aagacaagagttcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctag600 agacccggaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgaga660 ggagctaacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcaaat720 tagcatgttgtgtcagggtcccattcacatcctcaacaatcctgatgggaaaagtgaagg780 aatagaatcatcagacgaagagcaagataataacaacagtggaggggaagcagaattacc840 ggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaagtacag900 tggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcc960 caaagaagcaaggcagaagcttctcacgtggtgggaattgcattacaagtggccgtatcc1020 ttctgaatcagagaaggtggcgttggcggaatcaacggggttagatcagaaacagatcaa1080 caattggttc ataaaccaaa gaaaacgtca ctggaaaccg tccgaggaca tgcagttcat 1140 ggtgatggat ggtctacagc acccgcacca cgcagctcta tacatggatg gtcattacat 1200 gggcgatggt ccttatcgtc ttggaccata agagaccaca tgcagatatc cagaagggtt 1260 agccatataa taacaacctt ttgttgcctc tctcgtttac agttcatgat ttcaactttc 1320 cttcacaagt ttgctaccta tagctttatt ttcttacccg tatttaatgt cttatatcgt 1380 tcaaggggtt tgagacttcc tagtcatttt cactttttat tttgtatttt tcataatgtt 1440 ttatttataa tatgtgttct aataatgtgt gaaaagagat gtttttatga attttaaaaa 1500 aaaaaaaaaa aaaaa 1515 <210> 12 <211> 29 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 12 cgggatccat ggaagaatat caacatgaa 29 <210> 13 <211> 31 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 13 cgggatccgg taccttatgg tccaagacga t 31 <210> 14 <211> 1186 <212> DNA
<213> Brassica raga <400> 14 cgggatccat ggaagaatat caacatgaaa gcagatccac tcctcataga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa atgataacac caccaccaac aacaataata 120 ccaattatgg ttctggttac aataatacta ataacaataa tcatcaacaa cacatgttgt 180 tcccacatat gagctctctt cttcctcaaa cgactgagaa ttgcttccga tccgatcatg 240 atcagccaac caacgcatct gttaaatcag aagcaagctc ctcaagaatc aatcactact 300 ctatgttgat gaaagccatc cacaatactc aagaagctaa caacaacaac aacaacaayg 360 atatggaatccatgaaagctaagatcatcgctcatcctcactactccaccctcctacacg420 cctacttggactgccagaagattggagcaccacctgaagtggttgataaaattacggcgg480 caagacaagaattcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtcta540 gagaccccgaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgag600 aggagctaacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcaga660 ttagcatgttgtgtcagggtcccattcacatcctcaacaatcctgatgggaaaagtgaag720 gaatggaatcatcagacgaagagcaagataataacaacagtggaggggaagcagaattac780 cggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaaataca840 gtggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttc900 ccaaagaagcaaggcagaagcttctcacgtggtgggaattgcattacaagtggccgtatc960 cttctgaatcagagaaggtggcgttggcggaatcaacggggttagatcagaaacagatca1020 acaattggtt cataaaccaa agaaaacgtc actggaaacc gtccgargac atgcagttca 1080 tggtgatgga tggtctacag cacccgcacc acgcagctct atacatggat ggtcattaca 1140 tgggcgatgg cccttatcgt cttggaccat aaggtaccgg atcccg 118&
<210> 15 <211> 1180 <212> DNA
<213> Brassica oleracea <220>
<221> misc feature <222> (1078)..(1078) <223> n = a, c, g, or t <400> 15 cgggatccat ggaagaatat caacatgaaa gcagatccac tcctcataga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa atgataacac caccaccaac aacaataata 120 ccaattatgg ttctggttac aataatacta ataacaataa tcatcaacaa cacatgttgt 180 tcccacatat gagctctctt cttcctcaaa cgactgagaa ttgcttccga tccgatcatg 240 atcagcctac caacgcatct gttaaatcag aagcaagctc ctcaagaatc aatcactact 300 ctatgttgatgaaagccatccacaatactcaagaaactaacaacaacaacaatgatacgg360 aatccatgaaagctaagatcatcgctcatccccactactccaccctcctacacgcctact420 tggactgccagaagattggagcaccacctgaggtggtcgataaaattacggcggcaagac480 aagagttcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctagagacc540 cggaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgagaggagc600 taacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcaaattagca660 tgttgtgtca gggtcccattcacatcctcaacaatcctgatgggaaaagtgaaggaatag720 aatcatcaga cgaagagcaagataataacaacagtggaggggaagcagaattaccggaaa780 tagacccgag ggcggaagatcgggaactcaagaatcacttgctgaagaagtacagtggat840 acttgagcag tctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcccaaag900 aagcaaggca gaagcttctcacgtggtgggaattgcattacaagtggccgtatccttctg960 aatcagagaa ggtggcgttggcggaatcaacggggttagatcaaaaacagatcaacaatt1020 ggttcataaa ccaaagaaaacgtcactggaaaccgtccgaggacatgcagttcatggnga1080 tggatggtct acagcacccgcaccacgcagctctatacatggatggtcattacatgggcg1140 atggtcctta tcgtcttggaccataaggtaccggatcccg 1180 <210> 16 <211> 20 <212> DNA
<213> Artificial uence seq <220>
<223> PCR primer <400> 16 ataacaccac caccaacaac 20 <210> 17 <211> 20 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 17 actaggaagt ctcaaacccc 20 <210> 18 <211> 21 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 18 tcaacatgaa agcagatcca c 21 <210> 19 <211> 20 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 19 aacgagagag gcaacaaaag '20 <210> 20 <211> 3750 <212> DNA
<213> Brassica napus <400> 20 ataacaccac caccaacaac aataatacca attatggttc tggttacaat aatactaata 60 acaataatca tcaacaacac atgttgttcc cacatatgag ctctcttctt cctcaaacga 120 ctgagaattg cttccgatcc gatcatgatc agccaaccaa cgcatctgtt aaatcagaag 180 caagctcctc aagaatcaat cactactcta tgttgatgaa agccatccac aatactcaag 240 aagctaacaa caacaacaac aacaatgata tggaatccat gaaagctaag atcatcgctc 300 atccgcacta ctccaccctc ctacacgcct acttggactg ccagaaggtt atatagattt 360 agcactggat ttcgttttat ttttgttgta gtaatatata aaataccact cttgtttgtt 420 taaattaacg agatgatatg cgtaaatatg ttcacgggtt gcatatacag attggagcac 480 cacctgaagt ggttgataaa attacggcgg caacacaaga gttcgaggcg aggcagcagc 540 ggccaacagc atccgtaact gcgctgtcta gagaccccga attggatcaa ttcatggtaa 600 attaattatc aaactgaatt atagtgggtc gtttcttcaa gtgtatatgt taagtcttta 660 tttttgtttg tatcgtaaat tttatcaaca ggaagcatac tgtgatatgc tggttaaata 720 tcgagaggag ctaacacggc ccattgaaga agcaatggag tatatacgtc gtattgaatc 780 tcagattagc atgttgtgtc agggtcccat tcacatcctc aacaatcctg gtaaatgtca 840 taaaactcac aaatacatat acatgcatat acccacatgt aaccattgaa tgtagaaaag 900 aaaatataat gccaaggtag ggctcatgat gaatttcaag agcaacattg gcgcgtattt 960 ctttggttcc cgggaaagtt ttgtaccaat tagattatga taaggcgacc aaaaaataat 1020 tatgattata tttggttaaa atttttcatc taaacattca agtgttaatt aagatcataa 1080 aatataatag ttaatatgat agaaattcgt aggctgcaga cagatgtgca catttgctct 1140 tgttttccct attgtagaat ccatccaaag agggtggggc tttttttggt ttcttacttt 1200 taacccggcc caaagtacta ctgtcacaaa cactttttgt tgttcactat gaaaaaaaat 1260 acaaataggt attctcaatt ccagtatgca aaatgtttca aattttcata aaaaagtcag 1320 tacgactaaa ttgctcgtga attatgaatc aaaatataag actgatgaaa agctaaaatt 1380 tgaaacagat gggaaaagtg aaggaatgga atcatcagac gaagagcaag ataataacaa 1440 cagtggaggg gaagcagaaa ttaccggaaa tagacccgga gggcggaaga tcgggaactc 1500 aagaatcact tgctgaagaa gtacagtgga tacttgagca gtctaaagca agaactgtcc 1560 aagaaaaaaa agaaaggtaa acttcccaaa gaagcaaggc agaagcttct cacgtggtgg 1620 gaattgcatt acaagtggcc gtatccttct gtacgtataa ttttactctc atctctctat 1680 gctttcagtc ttttaaaata tacactctat ataaatacta gaaccagtct tttggaaaac 1740 aatgtagatg ctgggaatct ccaatttgcc ctgattttct ctaaagggcc ttccttaggc 1800 cgattaggct ctttgcaggg atcatttgta gatgctaggc tctttgcaga gataatttgt 1860 gttcaaacct ttatgcgttt ccatatttca taacatatgt atatatacat atatcaaaca 1920 cgtttttatc tatagttatc taaattttga aataattttg aagtttaagt ccgtggatct 1980 attgttatag tttatcagct tcaggaaata aaacaaataa aaccgaatgt ggtgatggcg 2040 aaggtcttta atattgggta tacatattta ccacaaaaaa aatgatatat tatatagaat 2100 ggctgtttgt tgttaaaaaa tcctggtatt ttttttggta aatatgatac catttccaat 2160 gaacaccaaa aatgatacca tcccaccaaa tttgttgtaa tgtaaaaagt attacaccaa 2220 attaacaata ttcattacac caaatattaa aataatatat tttattattt tttatttaat 2280 aatagataga ttagtttttt acttagttat aacttatagt taaaatgagt atatcataat 2340 atcttgtatt tttaatccat atttttacat tactaaaaca ttaaactatt attttatttt 2400 ataatttaat taatagtata taattaaatg agtattataa attatattaa atggtaacaa 2460 aataaaaatg atcttcattt taaatgcaaa aagttttaat ttttacaaat attttaaata 2520 aaataaataa taaagtatac acattmacta aaagaaaaat agcttatata aaaataaaat 2580 taccaaatat taatatatat atatatatat atataaacta aatgtgatac atatatataa 2640 ttagtcaatt ataaacaatt aatgtattaa attactaaaa ctaaaaagtt gataatataa 2700 aatattattt tggtgtagaa tttggtgtga tggttggaca tgaaaaataa agtttaacmc 2760 ttaaacmccm mtyctggtgt aatttcarca ctaattttag tgttatggtt ggagataccc 2820 taacagaacc atgcttcgtg ctttgaaaaa aaaatcagtc gtctaaagct acaataaaaa 2880 aattggaggg aaatattttg tttcaaatta ggttatgtat ttacacagat atttgtttgg 2940 attcttgtct gagaagtgca tggcattaca ttttgtgtta caaaagaagt tgaatgatct 3000 gagtatcata tttattgaaa gcgtgttggt atatgtgtgt tgctaaaaag ttctataaga 3060 aaattggata aatttgcttt aaaatttcca tagtatatca ctattttgta tgttcggaaa 3120 ccttgatatg tatacttttc ccttataacg agggccttaa tattctttag tcatctagat 3180 tgttcgaagc agcagactgt aatttataac ttcgtctgac tatcatctac cttttttata 3240 gaacatacct tttcttttat tgaaactaat atcgtctagc ttttgtgatt aaatctaccg 3300 tttttaaaca atgaacaata ctaaaaaagt gatgatatgg atatggttct gatttgtgtt 3360 gtgtggcagg agtcagagaa ggtggcgttg gcggaatcca acggggttag atcagaaaca 3420 gatcaacaat tggttcataa accaaagaaa acgtcactgg aaaccgtccg aagacatgca 3480 gttcatggtg atggatggtc tacagcaccc gcaccacgca gctctataca tggatggtca 3540 ttacatgggc gatggtcctt atcgtcttgg accataagag accgcatgca gatatccaga 3600 agggttagcc atataataac aaccttttgt tgcctctctc gtttacagtt catgatttca 3660 actttccttc acaagtttgc tacctatagc tttattttct tacccgtatt taatgtctta 3720 tatcgttcaa ggggtttgag acttcctagt 3750 <210> 21 <211> 30 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 21 catgatcgga tcggaagcaa ttctcagtcg 30 <210> 22 <211> 30 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 22 aaaagttgag agagaaagag agagagagag 30 <210> 23 <211> 840 <212> DNA
<213> Brassica napus <400> 23 aaaaaatgcttacaaatatctgcacatcaaccaatctgttacataaatagatcttcttgt 60 gggggtagggttaacaaatattttcctctttttcttttctcaaaaatgtatcggtactga 120 tatagccgcggagacctggttcattaaaacattggcggtacatcttaataatcaaaacat 180 tgacggcacatcttaatcctagagtttaaccacattatatatcatagagtaacaaactta 240 gtttttgacccaaaagaagaaaaaaaacttccaattttctagtacagaataagcctacga 300 gagggaaacagaagagaaaggaggaaagaagggaagcctttgccttatctcttgtccatt 360 ctctcttacctttatttttaattttcaaatatttattattgccaccaaagcaaacgacgt 420 cttgtcaatccactcaacccacccaacttcttaattattgttaacacatctctcctcttt 480 ctctctcatctttttataatttcttctcttccatgtcactttttgacgaattctatttac 540 ttagttcgttttttcttcctcaaaatatctcgttttcaatttatttgttttgttgggtgc 600 aacttcacctcacaattttttttatgaagcac.ctttctgattcgtagatatgagtcgtct 660 agtcatgtggatttgatttggttaaagtctaacatcgacctttgattgaaataaggacaa 720 aagaaagaatacatacatccccttcattttgcaCCCatccctttattttctagggtttta 780 tttttatcacattagttttttatattctctctctctctctctctttctctctcaactttt 840 <210> 24 <211> 950 <212> DNA
<213> Brassica napus <400> 24 aaatctttatcttctctgtttcttgtgcaatcttctatccgaaaacgagtacaatataat60 ctctctccaccgatgtaatacgaatatcaaatcagaaattaatcatttgatcatattctc120 aaaacatctaaatttattttacaaattgcttacaaatatctgcacatcaaccaatctgtt180 acataaatagatcttcttgtaggggtaaggttaacaaatatttttttctttttcttttct240 ccaaaatgtatcggtactgatatagccgcggagacctggttcatcaaaacattgacggta300 catcttaattcgagagtttaaccaaattatatcatagagtaacaaacttagtttttgacc360 caaaataagagaaaaaactttcaattttctaatacggaataagctatgagagggagacag420 aagagaaagtaggaaagaagggaagcctttgccttatctcttgtccattctctcttacct480 ttattttaattttcaaatatttattattgccaccaaagcaaacgacgtcttgtcaatcca540 ctcaacccacccaacttcttaattattgttaacacatctctcctctttctctctcatctt600 tttataatttcttctcttccatgtcactttttgacgaattctatttacttagttcgtttt660 ttcttcctcaaaatatctcgttttcaatttatttgttttgttgggtgcaacttcacctca720 caattttttttatgaagcacctttctgattcgtagatatgagtcgtctagtcatgtggat780 ttgatttggttaaagtctaacatcgacctttgattgaaataagaacaaaagaaagaatac840 atacatccccttcattttgcacccatccctttattttctagggttttatttttatcacat900 tagttttttatattctctctctctctctctctctttctctctcaactttt 950
The role of homeobox genes in defining body plan and their evolutionary relationships in animals is well documented (Gehring, W. J., Affolter, M. &
Burglin, T. (1994) Annu. Rev. Biochem. 63,487-526., Kappen, C. (2000) Proc.
Natl. Acad. Sci. USA 97, 4481-4486.) More recently, several plant knotted-like homeobox (KNOX) genes have been identified, which form two classes based upon sequence similarities and expression domains (Bharathan, G., Janssen, B., Kellogg, E. & Sinha, N. (1999) Mol. Biol. Evol. 16, 553-563., Reiser, L., Sanchez, B. P. & Hake, S. (2000) Plant Mol. Biol. 42, 151-166., Serikawa, K.
A., Martinet-Laborda, A. & Zambryski, P. (1996) Plant Mol. Biol. 32, 673-693.) In Arabidopsis, there are four different class I K1V0~ genes, STM, KNATl, KNAT~,and KNAT6 (Long, ibid., Lincoln, C., Long, J., Yamaguchi, J., Serikawa, K. & Hake, S. (1994) Plant Cell 6, 1859-1876. ~ Semiarti, E., Ueno, Y., Tsukaya, H., Iwakawa, H., Machida, C. & Machida, Y. (2001 ) Development 128, 1771-1783.) STM is expressed in the SAM, whereas KNATl and KNAT2 expression observed in the PZ of the SAM. KNATl is also expressed in the cortical cell layers of the peduncle and pedicel. STM, KNATl and KNAT2 expression is excluded from the leaf primordia and developing leaves by ASYMMETRICLEA TES 1 and 2 genes (Ori, N., Eshed, Y., Chuck, G., Bowman, J. L. & Hake, S. (2000) Development 127, 5523-5532., & Byrne, M., Barley, R., Curtis, M., Arroyo, J., Durham, M., Hudson, A. & Martienssen, R. (2000) Nature 408, 967-971 ). Ectopic expression of KNATI and KNAT2 in leaves induces altered symmetry and cell fate, and ectopic meristem/shoot formation from the adaxial surface (Chuck, G., Lincoln, C. & Hake, S. (1996) Plant Cell 8, 1277-1289). To date, loss-of function mutations in class I KNOX genes are known only for STM and these suggest a critical role in SAM maintenance and function. Significantly, however, no such mutations have previously been described for KIVATl , hampering study of the role of this homeobox gene in plant development.
The future prospects of engineering optimal plant architectures in plant species will depend on the availability of critical morphology controlling genes and knowledge of their functional regulatory properties. For example in canola, the occurrence of an inflorescence and silique with long pedicels may offer some unique challenges and opportunities to develop an ideal architecture for improving productivity.
In summary, there remains a continuing need to develop novel and efficient techniques for modifying the morphology and architecture of plants, such as for example Brassica and other plant types, to improve photosynthetic efficiency, overall yield, and harvestability. This need extends to both crops and to horticulturally grown species to improve aesthetic appeal.
SUMMARY OF THE INVENTION
The inventors of the present application have successfully identified the gene responsible for the brevipedicellus (bp) mutant in Arabidopsis. This mutation is known to give rise to plants having a very compact architecture with shortened siliques pointing downwards. Importantly, the inventors have realized that the successful identification of this gene has important implications on the generation of new crops and other plant species that exhibit advantageously modified morphological features.
In this regard, the inventors have discovered that the by mutation has several productivity advantages if introduced for example, into canola crop species. In Arabidopsis, the mutation results in reduced pedicel length, and siliques pointing downward with compact architecture. These features can improve exposure of upper leaves to sunlight and thereby enhance their photosynthetic efficiency: a well recognized problem in canola, especially during the pod setting and maturation stages. In addition, during harvesting the altered pod dynamics can reduce shattering losses, an important problem facing canola farmers. Further, the downward-pointing flowers may help in reducing disease incidence.
Therefore, the present invention relates, in one embodiment, to nucleic acid sequences derived from Arabidopsis encoding a homeobox gene involved in the control of inflorescence architecture, for use in modifying plant inflorescence architecture. In addition, the present invention relates in other embodiments to methods for modifying the morphological phenotype of plants, by introducing the nucleotide sequences encompassed by the present invention into a plant, and expressing the nucleotide sequences as appropriate.
In another embodiment, the present invention relates to nucleic acid sequences derived from A~°abidopsis encoding a homeobox gene involved in the control of inflorescence architecture, said homeobox gene differing from wild type by at least a change in an amino acid codon to produce a truncated protein.
The invention further relates to the proteins encoded by the nucleic acids encompassed by the invention, and their use.
The present invention also relates to methods for alteration of the expression of a native gene related to inflorescence structure, in particular the reduction in the expression of said gene.
In one aspect of the invention, nucleic acid sequences are provided that encode an altered protein that when expressed confers an altered inflorescence architecture phenotype in A~°abidopsis, particularly an inflorescence with. an altered pedicel, peduncle or style.
In one aspect of the invention, nucleic acid sequences are provided that encode an altered protein that when expressed confers an altered inflorescence architecture phenotype in Brassica, particularly an inflorescence with an altered pedicel, peduncle or style.
In another aspect of the present invention methods are described that enable the heterologous expression of the nucleic acid or portions or homologues thereof, described in SEQ ID NO: 5 in a host cell to obtain a plant with an altered inflorescence, more particularly an inflorescence with an altered pedicel, peduncle or style.
In yet another aspect of the present invention, methods are described wherein the nucleic acid sequence or regions thereof as described in SEQ ID
NO: 6 and nucleic acids homologous to same are used to alter the architecture of a flowering plant, in particular the inflorescence, more particularly the pedicel, peduncle or style.
In yet another aspect of the present invention, methods are described wherein nucleic acid sequence or regions thereof as described in SEQ ID. NO: 6 and nucleic acids homologous to same are used to alter the architecture of the inflorescence of a plant from the Crucifer (Cruciferae) family, particularly the pedicel, peduncle or style of said plant.
In yet another aspect of the present invention, methods are described wherein nucleic acid sequence or regions thereof as described in SEQ ID. NO: 6 and nucleic acids homologous to same are used to alter the architecture of the inflorescence of a plant from the Crucifer (Cruciferae) family, particularly the pedicel of said plant, said plant exhibiting an altered inflorescence, with compact internodes, downward pointing pedicels and siliques that point downward relative to the normal presentation of siliques.
In one embodiment, the present invention provides a method of producing a transgenic plant with a modified inflorescence architecture characterised in that the method comprises the steps of: (a) introducing into a plant cell capable of being transformed and regenerated into a whole plant a construct comprising, in 5 addition to the DNA sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNATI gene and encoding at least part of a KNATI gene product operably linked to a promoter; and (b) recovery of a plant which contains said nucleotide sequence and has a modified inflorescence architecture compared to an unmodified plant. Preferably, the 10 method involves nucleotide sequences encoding a peptide having at least 50%, preferably 70%, more preferably 90%, more preferably 95%, most preferably 99% homology to the peptide encoded by SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof. Preferably, the method involves nucleotide sequences that are able to bind under stringent conditions to SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof.
Preferably, the modification of inflorescence architecture comprises an altered pedicel, peduncle or style, and more preferably the altered pedicel has an altered length compared to an unmodified plant. Moreover, the modified inflorescence architecture preferably comprises downwardly pointing flowers.
In alternative embodiments, the invention provides methods characterised in that the nucleotide sequences are derived from a plant of the genus Arabidopsis or B~°assica and / or the transformed plants are of the genus Arabidopsis or Bnassica or are selected from the group consisting of: a dicot, a monocot, and a member of Cruciferae.
Preferably, the methods of the invention can generate a plant having either a compact or an open inflorescence compared to an unmodified plant. The nucleotide sequences may be expressed in a sense direction for complementary inhibition of an endogenous KNATI gene in the transgenic plant, such that the plant has a compact inflorescence architecture compared to an unmodified plant.
Preferably, the KNATl gene may be in a mutated form. In an alternative embodiment, the nucleotide sequence may be expressed in an antisense direction for antisense inhibition of an endogenous KNATI gene such that the plant has a compact inflorescence architecture and / or decreased pedicel length compared to an unmodified plant. In an further alternative embodiment, the nucleotide sequence may be overexpressed in a sense direction, such that the plant has an open inflorescence architecture and / or increased pedicel length compared to an unmodified plant.
In one aspect, the plant may harbour a by mutation such that expression of said nucleotide sequence is complementary to said mutation, inducing the plant exhibit a wild-type phenotype.
The promoters for use in accordance with the methods of the present invention may take various forms. For example, the promoter may comprise, in one embodiment a transcriptional regulatory region normally in operable association with an endogenous KNATI gene or homologue thereof. Alternatively, the promoter may comprise a transcriptional regulatory region that is not normally in operable association with an endogenous KNATI gene or homologue thereof.
Further, the promoter may be selected from the group consisting o~ a constitutive promoter, an inducible promoter, an organ specific promoter, a strong promoter, a weak promoter, and an endogenous KNATI promoter from Arabidopsis. Alternatively, the promoter may be derived from a functional portion of SEQ ID NO: 23 or SEQ ID NO: 24.
The present invention further encompasses methods for modifying the infloresence architecture of a plant involving the use of sequences homologous to SEQ ID NO: 5 or 6, such as, for example, SEQ ID NOS: 11, 14, 15, and 20.
In another embodiment, the present invention provides a method of identifying a plant that has been successfully transformed with a construct, characterised in that the method comprises the steps of (a) introducing into plant cells capable of being transformed and regenerated into whole plants a construct comprising, in addition to the DNA sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNATl gene and encoding at least part of a KNATI gene product, operably linked to a promoter; ,.(b) regenerating said plant cells into whole plants; and (c) inspecting the inflorescences of said plants to determine those plants successfully transformed with said construct, and expressing said nucleotide sequence. In a preferred embodiment, the plant cells and the regenerated whole plants harbour a by mutation, and successful transformation and expression of said nucleotide sequence complements said mutation, thereby generating a plant exhibiting a wild-type phenotype. More preferably, the construct is bicistronic and further comprises a second DNA
expression cassette for generating a transcript unrelated to said nucleotide sequence derived from a KNATI gene. In this way, the KNA TI-related portion of the construct can complement a known mutation in a plant and positively confirm transformation, and simultaneously a second transcript can be produced from a second region of the bicistronic construct, conferring desirable or otherwise properties to the transgenic plant.
The present invention further encompasses transgenic plants generated by any of the methods of the present invention. In this regard, the transgenic plants are preferably of the genus Anabidopsis or Br~assica or plants selected from the group consisting of a dicot, a monocot, and a member of Cruciferae. Moreover, the exogenous DNA or construct introduced into the plant may preferably be derived from plants of the genus Arabidopsis or Brassica.
The transgenic plants of the present invention preferably comprise a modified inflorescence (e.g. compact or open) compared to an unmodified plant.
Preferably the modified inflorescence architecture comprises an altered pedicel, peduncle or style, more preferably a plant with altered pedicel length or downwardly pointing flowers compared to an unmodified plant.
The present invention further encompasses, in other embodiments, isolated nucleotide sequences for generating a transgenic plant with modified inflorescence architecture, characterised in that the isolated nucleotide sequences are derived from a KNATI gene and encode at least part of a KNATI
gene product. The isolated nucleotide sequences preferably comprise a sequence selected from: (a) SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof; and (b) a nucleotide sequence encoding a peptide having at least 50%, preferably 70%, more preferably 90%, more preferably 95%, and most preferably 99% homology to the peptide encoded by the nucleotide sequence defined in (a).
Preferably the isolated nucleotide sequences of the present invention are characterised in that the nucleotide sequences hybridise under stringent conditions to the nucleotide sequence of SEQ ID NO: 5 or 6, or a part thereof or a complement thereof. The isolated nucleotide sequences for generating a transgenic plant with a modified inflorescence architecture compared to an unmodified plant, include sequences derived from a construct selected from the group consisting of: pRD400-951/955, pRD400-951/956, pRD400-35S::AtBPS, pRD400-35S::AtBPA/S, pRD400-35S::Atbp-2, pRD400-9511952::Atbp-2, pRD400-951/952::BnBPS, pRD400-35S::BnBPS, and pRD400-35S::BnBPA/S.
The present invention further encompasses, in further embodiments, the use of isolated nucleotide sequences related to the KNATl gene, for generating a transgenic plant with a modified inflorescence architecture.
BRIEF DESCRIPTIONS OF THE.DRAW1NGS
Figure 1. Illustration of the by BP phenotype in Arabidopsis. In this figure the phenotypes of 6 week-old Ler wt, bp-1 Ler and bp-2 Ler plants. (A)Whole plant:
Close-up of floral nodes with siliques of Ler wt (B) and bp-1 Ler (C). Close-up of inflorescence apex in Ler wt (D) and bp-1 Ler (E).
Figure 2. A comparison of internode and pedicel lengths between Ler wt, bp-1 Ler and bp-2 Ler. The histograms represent the percentage reduction in pedicel length for bp-1 and bp-2; the actual measurements in mm (mean values ~
standard deviation of 30 data points) are shown above,the corresponding bars.
The average pedicel lengths represent the values for the floral nodes 1-5. IN-l, IN-2, IN-3: coflorescence nodes l, 2, 3; FNl-5: floral nodes 1-5; FN6-10:
floral nodes 6-10.
Figure 3. SEM micrographs of inflorescences from Ler (A,B) and bp-1 Ler (C-E). (A) Ler wt floral nodes. (B) Ler wt peduncle internode magnified to show differentiated epidermal cells. (C) bp-1 floral nodes. (D,E) bp-I peduncle intemode showing stripes of less differentiated epidermal cells (arrows) that 5 originate below the node. Anatomy of the peduncle of Ler wt (F,H) and bp-I
(G,I). Cross sections through the internodal region of the peduncle of Ler wt (F) and bp-1 (G). Longitudinal sections through the nodal region of Ler wt (H) and bp-1 (I). Arrows in G demarcate a band of less differentiated cells that originate below the node, co, cortical cell layer; ad, adaxial; ab, abaxial. Bar = 0.1 mm 10 (A,B,D,E-I); 1 mm (C).
Figure 4. Pedicel development in Ler wt (A-E, K,L) and bp-1 Ler (F-J, M,N).
SEM of pedicel of stage 12 flower of Ler wt (A) showing complete epidermal cell differentiation on both the adaxial (B) and abaxial (C) sides. Pedicel of 15 stage 12 flower of bp-1 (F) with narrow distal end (E-), differentiated adaxial (G) and less differentiated abaxial (H) sides. SEM of stage 13 flower of Ler wt (D) and its pedicel (E). Stage 13 flower of bp-1 (I) and its pedicel (J) showing less differentiated abaxial side. Cross section through the mid-region of the pedicel of Ler wt (K) and bp-1 (L) and the distal end of the pedicel of Ler wt (M) and bp-1 (N). Bar =1 mm (A,D,F,I); 0.1 mm (B,C,E,G,H,J-N). ad, adaxial;
ab, abaxial. ' Figure 5. SEM of the style of a stage 17 flower of Ler wt (A}, and bp-1 Ler (D).
Longitudinal sections through the style of Ler (B) and bp-1 (E). Cross sections through the style of Ler wt (C) and bp-1 (F). Arrows in D-F indicate the lateral axis. Bar = 0.1 mm. sp, stigmatic papillae; st, style.
Figure 6. Southern blot and RT-PCR of KlVATl. (A) Southern blot. Genomic DNA from Col wt (lanes 1 and 2), Ler wt (lanes 3 and 4), RLD wt (lanes 5 and 6), bp-1 Ler (lanes 7 and 8), and bp-2 RLD (lanes 9 and 10) was digested with BamHI (lanes 1, 3, 5, 7, 9) or EcoRI (lanes 2, 4, 6, 8, 10).and probed with the KNATI cDNA. Sizes of the MW standards (kb) are indicated. (B) RT-PCR
using K1VAT1 primers 954 and 955. Lane 1, Col wt; lane 2, RLD wt; lane 3, Ler wt; lane 4, bp-1 Ler; lane 5, bp-2 Ler; lane 6, bp-2 RLD; lane 7, bp-2 Col.
The same cDNA pools were amplified with primers specific for gapC.
Figure 7. Sequences of the polymorphic regions of the BP-encoding cDNAs from Col wt, RLD wt, Ler wt, and bp-2. Numbering is shown for the Col wt sequence (GenBank U14174). Stop codons are indicated by an asterisk.(*), nucleotide and 25 amino acid deletions relative to Col wt are indicated by a dash (-), and nucleotide and amino acid insertions relative to Col wt are indicated in parentheses (). The C-T transition that causes a stop codon at position 535 in bp-2 is shown in bold. Nucleotides downstream of position 540 were identical among all of the BP-encoding genes analyzed and are not shown.
Figure 8. Vector map of the plant transformation vector referred to as pRD400-9511955, comprising of the KNAT1 cDNA cloned downstream of the putative KNATI promoter.
Figure 9. Vector map of the plant transformation vector referred to as pRD400-951/956, consisting of the putative KNATI promoter and the KNATI-encoding ORF amplified from genomic DNA.
Figure 10. Vector map of the plant transformation vector referred to as pRD400-35S::AtBPS, consisting of the A. thaliana BP ORF under the control of the 35S
promoter.
Figure 11. Vector map of the plant transformation vector referred to as pRD400-35S::AtBPA/S, consisting of the A. thaliana BP ORF in an antisense orientation under the control of the 35S promoter.
Figure 12. Vector map of the plant transformation vector referred to as pRD400-35S::Atbp-2, consisting of the altered BP gene coding sequence (SEQ
ID. NO: 6) under the control of the 35S promoter. The asterisk denotes the approximate location of the stop colon that results in a truncated predicted protein.
Figure 13. The vector pRD400-951/952::Atbp-2, consisting of the A. thaliana bp-2 cDNA under the control of the A. thaliana KNATI promoter. The asterisk denotes the approximate location of the stop colon that results in a truncated predicted protein.
Figure 14. The map of the vector of pRD400-951/952::BnBPS, consisting of the B, napus BP ORF (SEQ ID. NO: 11) under the control of the A. thaliana KNATI
promoter.
Figure 15. The vector map of pRD400-35S::BnBPS, consisting of the B. napus BP ORF (SEQ ID NO: 11) under the control of an optimized cauliflower mosaic virus (CaMV) 35S promoter.
Fig 16. The vector map pRD400-35S::BnBPA/S, consisting of the B. napus BP
ORF (SEQ ID NO: 1) in an antisense orientation under the control of the 35S
promoter.
DETAILED DESCRIPTION OF THE INVENTION
Definitions The singular forms "a," "an," and "the" include plural reference unless the context clearly dictates otherwise.
A "coding sequence" or "coding region" is the part of a gene that codes for the amino acid sequence of a protein, or for a functional RNA such as a tRNA or rRNA. A coding sequence typically represents the final amino acid sequence of a protein or the final sequence of a structural nucleic acid.
Coding sequences may be interrupted in the gene by intervening sequences, typically intervening sequences are not found in the mature coding sequence.
A "polynucleotide encoding an amino acid sequence" refers to a nucleic acid sequence that encodes the genetic code of at least a portion of a mature protein sequence, typically a contiguous string of amino acids typically linked through a peptide bond. An "amino acid sequence" is typically two or more amino acid residues, more typically 10 or more amino acids in a specific defined order.
A "complement" or "complementary sequence" is a sequence of nucleotides which forms a hydrogen-bonded duplex with another sequence of nucleotides according to Watson-Crick base-pairing rules. For example, the complementary base sequence for 5'-AGCT-3' is 3'-TCGA-5'.
"Expression" refers to the transcription of a gene into structural RNA
(rRNA, tRNA) or messenger RNA (mRNA) with subsequent translation into a protein in the case of the mRNA.
Polynucleotides are "functionally equivalent" if they perform substantially the same biological function. By substantially the same biological function it is meant that similar protein activities or protein function are encoded by a mRNA polynucleotide, or a structural polynucleotide has a similar structure and biological activity.
Polynucleotides are "heterologous" to one another if they do not naturally occur together in the same arrangement in the same organism. A
polynucleotide is heterologous to an organism if it does not naturally occur in its particular form and arrangement in that organism.
Polynucleotides or polypeptides have "homologous" or "identical"
sequences if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described herein. Sequence comparisons between two or more polynucleotides or polypeptides are generally performed by comparing portions of the two sequences over a portion of the sequence to identify and compare local regions.
The comparison portion is generally from about 20 to about 200 contiguous nucleotides or contiguous amino acid residues or more. The "percentage of sequence identity" or "percentage of sequence homology" for polynucleotides and polypeptides, such as 50, 60, 70, 80, 90, 95, 98, 99 or 100 percent sequence identity may be determined by comparing two optimally aligned sequences which may or may not include gaps for optimal alignment over a comparison region, wherein the portion of the polynucleotide or polypeptide sequence in the comparison may include additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
The percentage of homology or similarity is calculated by: (a) determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions; (b) dividing the number of matched positions by the total number of positions in the window of comparison; and, (c) multiplying the result by 100 to yield the percentage of sequence identity.
Optimal alignment of sequences for comparison may be conducted by computerized implementations of known algorithms, or by inspection. Readily available sequence comparison and multiple sequence alignment algorithms are, respectively, the Basic Local Aligmnent Search Tool (BLAST) (Altschul, S.F. et a11990. J. Mol. Biol. 215:403; Altschul, S.F. et a11997. Nucleic Acids Res.
25:
3389-3402) and ClustalW programs. BLAST is available on the Internet at http://www.ncbi.nlm.nih.gov and a version of ClustalW is available at http://www2.ebi.ac.uk. Other suitable programs include GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group (GCG), 575 Science Dr., Madison, WI). For greater certainty, as used herein and in the claims, "percentage of sequence identity" or "percentage of sequence homology" of amino acid sequences is determined based on optimal sequence alignments determined in accordance with the default values of the BLASTX program, available as described above.
Sequence. identity typically refers to sequences that have identical residues in order, whereas sequence similarity refers to sequences that have similar or functionally related residues in order. For example an identical polynucleotide sequence would have the same nucleotide bases in a specific nucleotide sequence as found in a different polynucleotide sequence. Sequence similarity would include sequences that are similar in character for example purines and pyrimidines arranged in a specific fashion. In the case of amino acid sequences, sequence identity means the same amino acid residues in a specific order, where as sequence similarity would allow for amino acids with similar chemical characteristics (for instance basic amino acids, or hydrophobic amino acids) to reside within a specific order.
The terms "stringent conditions" or "stringent hybridization conditions" includes reference to conditions under which a probe will hybridize to its target sequence, to a detectably greater degree than other sequences (e.g. at least 2-fold over background). Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. Generally, stringent conditions are selected to be about 5 ° C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH at which 50% of a complementary target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g. 10 to 50 nucleotides) and at least about 60°C for long probes (e.g. greater than 50 nucleotides).
Stringent conditions may also be achieved with the addition of destabilizing agents such as fonnamide. Exemplary low stringency conditions include hybridization with a buffer solution of 30% formamide, 1 M NaCI, 1 % SDS at 37°C, and a wash in 2X SSC at 50°C. Exemplary high stringency conditions include hybridization in 50% fonnamide, 1 M NaCl, 1% SDS at 37°C, and a wash in O.1X SSC at 60°C. Hybridization procedures are well-known in the art and are described in Ausubel et al.,(Ausubel F.M., et x1.,1994, Current Protocols in Molecular Biology, John Wiley & Sons Inc.).
"Isolated" refers to material that is: (1) substantially or essentially free from components which normally accompany or interact with it as found in its naturally occurring environment; or (2) if in its natural environment, the material has been non-naturally altered to a composition and/or placed at a locus in the cell not native to a material found in that environment. The isolated material optionally comprises material not found with the material in its natural environment. For example, a naturally occurring nucleic acid becomes an isolated nucleic acid if it is altered, or if it is transcribed from DNA which is altered, by non-natural, synthetic methods performed within the cell from which it originates.
Two DNA sequences are "operably linked" if the linkage allows the two sequences to carry out their normal functions relative to each other. For instance, a promoter region would be operably linked to a coding.sequence if the promoter were capable of effecting transcription of that coding sequence and said coding sequence encoded a product intended to be expressed in response to the activity of the promoter.
A "polynucleotide" is a sequence of two or more deoxyribonucleotides (in DNA) or ribonucleotides (in RNA).
A "DNA construct" is a nucleic acid molecule that is isolated from a naturally occurring gene or which has been modified to contain segments of nucleic acid which are combined and juxtaposed in a manner which would not normally otherwise exist in nature.
A "polypeptide" is a sequence of two or more amino acids.
A "homeobox" gene is a gene that is typically involved the developmental process of an organism, and usually contains one or more specific regions within the encoded protein that include a DNA binding region and a. second region that is distinct from the binding region. Homeobox genes typically contain a homoedomain that is homologous or has similarity to other homeodomain found in other homeobox genes.
A "promoter" or transcriptional regulatory region is a cis-acting DNA
sequence, generally located upstream of the initiation site of a gene, to which RNA polymerase may bind and initiate correct transcription.
A "recombinant" polynucleotide, for instance a recombinant DNA
molecule, is a novel nucleic acid sequence formed through the ligation of two or more nonhomologous DNA molecules (for example a recombinant plasmid containing one or more inserts of foreign DNA cloned into it).
"Transformation" means the directed modification of the genome of a cell by the external application of recombinant DNA from another cell of different genotype, leading to its uptake and integration into the subject cell's genome.
A "transgenic plant" encompasses all descendants; hybrids, and crosses thereof, whether reproduced sexually or asexually, and which continue to harbour the foreign DNA.
10 An inflorescence is a portion of a flowering plant that produces and supports flower development and typically seed formation. An inflorescence is usually formed from a meristem structure. The terms "inflorescence" and "flowering stalk" are used interchangeably herein.
Unless defined otherwise all technical and scientific terms used herein 15 have the same meaning as commonly understood to one of ordinary skill in the art to which this invention belongs.
The present application describes nucleic acids encoding a gene from A~abidopsis referred to as the BP gene, or the gene encoding the b~evipedicellus 20 phenotype, and the role of said gene in determining inflorescence morphology.
Said gene is a member of the KNOX gene family in Arabidopsis that is involved in control of certain aspects of flower development. The gene identified in the present invention represents an altered form of the wild-type gene. As a result of the present discovery, it was found that the wild-type gene is normally 25 involved in the control of the architecture of the inflorescence or at least the pedicel, peduncle and style structures within the inflorescence.
The gene sequences responsible for the by phenotype have not been previously identified and hence the molecular nature of the by mutation was not known prior to this disclosure. Accordingly, the utility of the by mutation for practical purposes has not been described. The present invention identifies the molecular basis of the by mutation and methods for using the gene encoded by the BP locus in alteration of plant inflorescence structure.
The present application further describes the discovery that the alteration in the expression levels of said gene, in particular the reduction in expression of said gene, or expression of an altered protein form of said gene results in changes in the inflorescence structure. Loss of function of said gene results in a compact inflorescence structure with changes in the length of the internodes, pedicle length and angle of seed pod attachment. The invention also provides evidence that gain of function can restore a wild-type phenotype, hence providing direction on alteration of inflorescence structure towards a compact structure or a structure that exhibits a less compact, more spread out structure.
The present application further describes the molecular basis of two loss of function alterations, providing a basis for the engineering of altered inflorescence architecture. In the present invention, the methods for the alteration of inflorescence architecture were shown to be: loss of the expression of the gene itself (inhibition of gene expression); and loss of function by expression of an altered form of the protein (expression of altered protein).
Accordingly, it is anticipated that the engineering of similar loss of function phenotypes in numerous flowering plant species can be easily and routinely accomplished by the use of methods described herein to identify, modify and alter the expression of the normally encoded gene or genes related to said nucleic acid sequences described herein. Thus, the present invention encompasses plants with altered inflorescence structures, in particular plants with an altered pedicel, peduncle or style can be obtained, alone or in combination, to produce an altered inflorescence structure.
Portions of the gene sequence representing the native wild-type protein coding sequence described in the present invention were found to be identical to the previously identified homeobox gene called KIVATl, but the involvement of the KNATI gene in the control of the inflorescence architecture or its association with the by phenotype have not previously been described nor anticipated.
Indeed, the previous studies (Lincoln et al, Plant Cell, 6: 1859- 1876, 1994) on the KNATI gene expression failed to identify a primary role for the gene in inflorescence architecture, suggesting that the expression of the KNATI gene was restricted in its expression in the inflorescence. No indication of the role of KNATI in peduncle, pedicle or style formation was suggested. Efforts to determine the function of the KNATI gene in this study were restricted to ectopic constitutive expression of the KNATl native coding sequence. No loss of function information for the KNATI was provided hence no definition of the nature of the activity of KIVATl could be inferred from these studies.
Accordingly the art did not describe a function for the KNATl gene, nor for that matter link the expression of the KNATI gene with the by mutant.
The present invention has thus assigned function to the KNATl gene, identified altered forms of the KNATl gene as the basis of the BP phenotype and provides methods for the alteration of wild-type gene expression to produce altered inflorescence, in particular inflorescence structures with alterations in the peduncle, pedicel or style or combinations thereof.
The present invention encompasses the use of the KNATI gene, and parts thereof, complements thereof, and homologues thereof, for generating transgenic plants with altered inflorescence structures. The present invention also encompasses the use of nucleic acid sequences encoding peptides having at least 50% homology, preferably 70% homology, preferably 90%, more preferably 95%, most preferably 99% to the peptides encoded by the KNATI
gene or SEQ ID NOS: 5 and 6. In this regard, homologous proteins with at least 50% or 70% predicted amino acid sequence homology are expected to encompass proteins with activity as those defined by the present invention, wherein disruption of expression or overexpression of the homologous proteins is expected to generate plants with altered structure as described in the present application. Such proteins may be derived from similar or unrelated species of plant.
The present invention also encompasses polynucleotide sequences encoding peptides comprising at least 90%, 95% or 99% sequence homology to the peptides encoded by the KNATl gene or SEQ ID NOS: 5 and 6. This class of related proteins is intended to include close gene family members with very similar or identical catalytic activity. In addition, peptides with 90% to 99%
amino acid sequence homology may be derived from functional homologues of similar species of plant, or from directed mutations to the sequences disclosed in the present application.
The present invention demonstrates the utility of said nucleic acid sequences and altered forms of the protein encoded by said nucleic acid sequences in controlling inflorescence development and hence assigns a novel utility for the use of the KNATI gene, and homologues thereof; to alter floral structure in flowering plants.
The nucleic acid sequences provided in the present invention can be used to alter plant morphology by heterologous expression, for example, of the nucleic acid sequences shown in SEQ ID. NOS: 5 and 6 and other homologous sequences as described herein.
The nucleic acid sequence of SEQ ID. NO: 5 encodes a I~NAT1 protein that has been shown in the present invention to be involved in maintaining the normal development of an inflorescence of a flowering plant, wherein expression of the protein confers the normal architecture of the inflorescence of a flowering plant. The protein represents a member of the homeodomain proteins involved in the control of plant development.
The nucleic acid sequence of SEQ ID. NO: 6 encodes an altered form of the KNATl protein, herein referred to as the BP related protein that is preferentially expressed in the inflorescence of a flowering plant, wherein expression of the protein influences the architecture of the inflorescence of a flowering plant. This protein represents an altered member of the homeodomain proteins involved in the control of plant development.
The present invention encompasses the expression of nucleotide sequences derived from the KNATI gene, includingSEQ ID Nos. 5 and 6 or homologues thereof to alter the inflorescence of a flowering plant by using said' polynucleotides to alter the expression of the protein normally expressed by KNATl and related genes using methods familiar to those of skill in the art.
In one aspect of the present invention, a gene sequence is used to modify the architecture of a inflorescence in a flowering plant by heterologous expression of the coding sequence of SEQ ID. NO: 6 or parts thereof, or complements thereof, or homologues thereof.
In another aspect of the present invention, one or more portions, of at least 50 amino acids, but less than 400 amino acids, most preferably about 179 amino acids of the protein encoded by the nucleic acid sequence of SEQ ID.
NO: 6 are expressed in a host plant, said expression causing the alteration of 10 inflorescence architecture as illustrated herein.
In another aspect of the present invention, the nucleic acid sequence, or coding region thereof described in the KNATI gene or in SEQ ID NO: 5 or 6 can used to modify the inflorescence of a flowering plant by using said sequence to 15 isolate a homologous nucleic acid that encodes a protein that is at least 50%
homologous to the protein encoded by SEQ ID. NO: 6 and expressing said homologous nucleic acid as part of a recombinant DNA construct in a host plant species. The recombinant DNA construct so expressed is engineered to express an altered form of the wild-type protein, or engineered to reduce the expression 20 of the wild-type gene. Method for the identification and isolation of homologous DNA sequences are very well known in the art and are included, for example in Sambrook et al., Molecular Cloning: A LaboYatofy Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y.(1989).
25 It will also be understood to a person of skill in the art that site-directed mutagenesis techniques are readily applicable to the polynucleotide sequences of the present invention, to make the sequences better suited for use in generated morphologically modified transgenic plants. Related techniques are well understood in the art, for example as provided in Sambrook et al., Moleculaf-Cloning: A Labof-atofy Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y.(1989). In this regard, the present invention teaches the use of nucleotide sequences derived from the I~NAT1 gene, including, for example SEQ ID NOS:
5 and 6. However, the present invention is not intended to be limited to these specific sequences. Numerous directed mutagenesis techniques would permit the non-informed technician to alter one or more residues in the nucleotide sequences, thus changing the subsequently expressed polypeptide sequences.
Moreover, commercial 'kits' are available from numerous companies that pernlit directed mutagenesis to be carried out (available for example from Promega and Biorad). These include the use of plasmids with altered antibiotic resistance, uracil incorporation and PCR techniques to generate the desired mutation. The mutations generated may include point mutations, deletions and truncations as required. The present invention is therefore intended to encompass corresponding mutants of the KNAT1 gene, both cDNA and genomic DNA
sequences in accordance with the teachings of the present application.
The polynucleotide sequences of the present invention must be ligated into suitable vectors before transfer of the genetic material into plants. For this purpose, standard ligation techniques that are well known in the art may be used.
Such techniques are readily obtainable from any standard textbook relating to protocols in molecular biology, and suitable ligase enzymes are commercially available.
In another aspect of the present invention, 'the KIVATl gene sequence, and parts, complements, and homologues thereofare used to modify a plant inflorescence by the transformation of plant cells With a plant transformation vector comprising a coding, for example, a region of said nucleic acid described in SEQ ID. NO: 6 under the control of a heterologous or native/homologous promoter.
In another aspect of the present invention, the nucleic acid sequence described in SEQ ID. NO: 6 is used to modify plant inflorescence architecture by the transformation of plant cells with a plant transformation vector comprising a coding region of said polynucleotide under the control of the promoter normally associated with the nucleic acid sequence found in SEQ ID
NO: 6.
In one aspect of the present invention, the nucleic acid described in SEQ
ID NO: 6 is used to alter the phenotype of an Ai°abidopsis plant by introduction of said nucleic acid or portion thereof into an As-abidopsis plant and recovering a plant wherein the inflorescence architecture of the plant has changed as a result of the introduction of the nucleic acid sequence, or portion thereof into the plant.
In one aspect of the invention these nucleic acid sequences may be used for identification of related homologous sequences deposited in public databases through comparative techniques well-known in the art, or as a hybridization probe for the identification of related cDNA or genomic sequences from various species, including plant species where the DNA sequence information is not known. In particular it is contemplated that these sequences so described can be used for the isolation of plant genes encoding similar activities.
In another aspect of the present invention, nucleic acids encoding a protein at least 50% homologous to the protein encoded by SEQ ID. NO: 6 are isolated and said nucleic acids are used to alter the phenotype of the inflorescence of the plant species from which they were derived by introduction of said nucleic acid or portion thereof into said plant species and recovering a plant wherein the inflorescence architecture of the plant has changed as a result of the introduction of the nucleic acid sequence, or portion thereof into the plant species.
In another aspect of the present invention, said nucleic acids that encode . a protein at least 50% homologous to the protein encoded by SEQ ID. NO: 6 are used to alter the inflorescence architecture of a flowering plant by introduction of said nucleic acid into a plant species heterologous to the plant species from which said nucleic acid sequence was derived.
In yet another aspect of the present invention, the nucleic acid sequence described in SEQ ID. NO: 6 is used as a visible marker for plant transformation, said marker producing plants with an altered inflorescence architecture relative to plants not transformed with the same.
In order to isolate. nucleic acid sequences involved in inflorescence architecture, mutant plant lines with altered inflorescence architecture were analyzed. A mutant in Arabidopsis designated as by has been described that exhibits a significant reduction in pedicel length (~80-90%) along with shortening in the intemodal regions (40-60%). The by mutant was first described by Koornneef et al in 1983 (ibid.) and has been used extensively in mapping studies as a classical chromosome 4 marker. However, no studies explaining the developmental or molecular basis of this mutation have been published to date.
In the present invention, mutant alleles of this gene were isolated by screening T-DNA insertional lines for by phenotypes. A line was found that showed a by mutant phenotype. As described herein, this isolated line was designated as bp-2 and the Koornneef isolate as bp-1. Thus, a new by mutation was discovered by the present inventors.
In order to establish the basis of the new mutation, pure lines with single recessive alleles of bp-1 and bp-2 were established in Arabidopsis ecotypes Landsberg erecta (Ler) and Columbia (col).
These lines were analyzed for architectural changes by Scanning Electron Microscopy (SEM) and the results indicated that epidermal cell differentiation is affected in both pedicel and internodes. Detailed SEM
analysis of the pedicel showed that in the abaxial region (lower side), epidermal cell differentiation is more affected compared to the adaxial region (upper side) in addition to an overall reduction in cell divisions along the whole pedicel.
Thus, the more pronounced abaxial changes in differentiation coupled with reduced cell division contribute to the change in the pedicel attachment angle and as a result produced shortened siliques (seed pods) pointing downwards in the BP
mutant. This provides an architectural change in the morphology of the pedicel, leading to a plant with an altered inflorescence.
Cross sections through the internodal regions showed that in addition to alterations in epidermal cell differentiation, the sub-epidermal cortical region was changed in by lines. In these lines, this region showed more intercellular spaces with larger cortical cells. Analysis of pedicel cross sections also revealed similar changes. Analysis of longitudinal sections through the nodes showed there were fewer cells (between floral nodes) in the by lines compared to wild-type lines. The presence of fewer cells in the internodes is indicative of reduced cell divisions in this region, consistent with the significantly reduced internodal 5 length in the by lines.
The anatomical analysis clearly demonstrates that changes in cell differentiation coupled with reduced cell division contributes to the altered, compact architectural phenotype in the by lines. Accordingly, the changes in the 10 architecture of the plant as a result of the BP mutation (or loss of its function) provide a new and valuable phenotype for flowering plants with a compact inflorescence and downward pointing seed pods.
Genetic analysis established that bp-2 is allelic to bp-1 previously 15 mapped on chromosome 4. The bp-2 mutant phenotype is not physically linked to the T-DNA. The present inventors used a novel strategy of positional cloning to isolate the gene sequences associated with the by phenotype.
The available genetic and recombination data suggest that the by locus is 20 located in between the marker DET2 and the centromere on chromosome 4. The genomic sequence corresponding to this region (~1.5 Mb) has been determined.
To clone the BP gene, a region between DETl and the centromere on chromosome 4 was chosen, based on genetic maps compiled from several data sets (http:llwww.Arabidopsis.org; (Pepper, A., Delaney, T., Washburn, T., 25 Poole, D. & Chory, J. (1994) Cell 78 ). As the loss-of function BP mutation mainly affects the pedicel and internodal regions but not the leaves, the BP
transcripts are also likely differentially expressed. Probes corresponding to differentially expressed transcripts were prepared from the pedicel and internodal region and were used for subtraction hybridization with leaf expressed transcripts to identify potential BP candidate genes from this ~1.5 Mb genomic region.
Radioactively labeled probes representing the transcripts preferentially . expressed in the pedicel and intemodal region were generated and hybridized the probes to restriction-digested overlapping BAC DNAs completely covering this region of chromosome 4. The results showed a single hybridizing band representing a ~20-kb BamHI fragment from BAC clone F9M13 (Mayer KFX, Schiiller CME, et al. (1999) Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana. Nature 402:769-777.) The annotation and BLAST analysis of this ~20 kb sequence showed only one potential gene, with 100% identity to the previously reported homeodomain containing protein KNATI (Lincoln, C., Long, J., Yamaguchi, J., Serikawa, I~. 8z Hake, S. (1994) Plant Cell 6, 1859-1876.).
Previous reports in the art have mapped the KNATl gene to chromosome 5, however, the assignment of the chromosomal location of the KIVATl gene has now been found to be in error. Utilizing the sequence comparison available based on screening the whole Arabidopsis genome demonstrated that the KNATI
gene as well as the sequence of the BAC clone F9M13 containing the BP gene to be located on chromosome 4. Thus, it was established that the KNATI gene resides on chromosome 4, not 5 as previously reported.
This discovery shows that the previously described KNATI gene, formerly thought to be on chromosome 5 and encoding a protein previously thought to be involved in 'various facets of plant development, is the gene affected in the by mutation and is in fact intimately involved in the control of inflorescence architecture.
Whereas the previous study with the ~KNATI gene demonstrated that overexpression of the coding region of the gene (cDNA) under CaMV 35S
promoter produced several abnormal phenotypes including the ectopic production of meristems from adaxial (upper) surface of the leaves and altered leaf shape, the involvement of KNATI in pedicel architecture and control of inflorescence was not reported. The art failed to provide correlation between KNATI and the by mutation herein described. Hence function of the I~NNAT1 gene was not assigned nor was the utility of the gene for controlling inflorescence architecture known or suggested. In addition, the chromosomal location of I~1VAT1 was also incorrectly reported further confusing the nature and utility of the KIVATl gene.
However, as described herein, the second by phenotype, bp-2 was unequivocally established as residing on chromosome 4 within the BAC F9M13 clone. Since the bf°evipedicellus (bp) mutation was described before the report of KNATI , the inventors adopted the BP designation for this locus, according to conventional practice.
To determine if sequence differences. existed between bp-1, bp-2 arid wild type plants at the BP locus, a Southern blot with restriction digested genomic DNAs as target and the BP (KNATl) cDNA as probe was carned out.
It was demonstrated that the bp-1 (Ler) lacks the BP (KNATI ) gene entirely, indicating that a deletion of this gene had occurred in this mutant. In contrast, bp-2 showed hybridizing bands similar to wild type. Thus bp-1 represents a deletion mutation of the BP gene, (or the KNATI gene) whereas bp-2 represents an alteration of the gene (and encoded protein) itself.
The expression of the BP transcripts in mutant and wt plants was analyzed. RT-PCR results confirm that bp-1 produces no BP transcript, while' bp-2 produces an apparently full-length transcript comparable to the wild type.
To identify the molecular basis for the bp-2 mutant phenotype, BP-encoding RT-PCR products from duplicate reverse transcription reactions using Ler (wt), RLD (wt), bp-~ (col), bp-2 (Ler), and bp-2 (RLD) were then cloned and their sequences determined.
In wt Ler and RLD the BP ORFs encoded predicted proteins of 400 amino acids, compared with a predicted protein of 398 amino acids for col wt.
Minor sequence polymorphisms among the three wild-type BP cDNAs were detected, some of which resulted in differences in the predicted proteins. The BP gene, or KNATI gene contains two domains, a homeodomain , and an ELK
region as typically found in plant and animal homeobox genes.
Changes were noted between wild-type and mutant BP proteins (bp-2 protein from Ler, col and RLD by lines). In particular, the third and fourth asparagine/histidine-rich regions contained differing numbers of N residues among the three predicted proteins, which accounted for the differences in the' total number of amino acids. The predicted BP proteins from bp-2 (col), bp-2 (Ler), and bp-2 (RLD) were identical and contained several unique polymorphisms compared with the wt sequences, hence the altered protein structure of the protein encoded by the bp-2 gene, confering altered functionality. This similarity between the different bp-2 proteins is expected since the original bp-2 mutation was introgressed into these three backgrounds.
Interestingly, within the wt BP protein, minor polymorphisms were identified.
Thus, protein polymorphisms are found in both wt and bp-2 proteins. For example, the third N-rich region contained only three N residues in the bp-2 lines, compared with five in col (wt) and six each in Ler (wt) and RLD (wt).
Most importantly, bp-2 contained a C-T transition corresponding to position of the col (wt) ORF. This point mutation changed codon 179 from cag to tag, thereby introducing a stop codon and resulting in a truncated predicted protein.
The predicted BP protein of bp-2 is truncated upstream of both the important homeodomain and ELK regions, and as result this protein would not be expected to have normal function.
Further supporting evidence was obtained by transforming the bp-1 and bp-2 mutant lines with wild type BP genomic and cDNA constructs, which showed complementation of the mutant phenotype in transgenic plants and restoration of wild-type plant architecture.
In addition to simple complementation, control of inflorescence architecture can be regulated by expression levels of wt BP protein. The pedicels in col wt are much longer than Ler wt pedicels. Based on expression analysis, it was found that there is a 2-4 times higher transcript level of wt BP mRNA in col wt ecotype when compared to Ler wt, indicating that transcriptional regulation of BP contributes to the observed differences between these ecotypes. Thus, reducing the BP transcript levels can lead to a significant reduction in pedicel and internodal length. It is also desirable to increase the length of pedicel and/
or internodes by up-regulating the expression of BP functional homologues.
Thus, the results presented herein provide obvious strategies for the manipulation of inflorescence architecture.
Accordingly, the present invention ascribes a function to a previously identified homeobox gene, IfNATl, demonstrating that IfNATI encodes a gene normally involved in the control of inflorescence development. This invention also demonstrates that KNATI is located on chromosome 4, not 5 as previously 10 reported. In addition, this invention demonstrates the function of the KNATI
gene in pedicel architecture and demonstrates alterations in the coding sequence of the K1VAT1 gene can lead to a by phenotypes thus establishing KNATI as the BP gene.
15 For the purposes of the present invention, nucleic acid sequences encoding a protein with substantial homology of 50% or more to the protein encoded by Seq ID. NO: 5, said proteins at least differentially expressed in the inflorescence of a flowering plant, and having a role in regulating inflorescence architecture, are herein referred to as "BP" coding sequences, encoding a "BP"
20 protein. Hence a "BP gene" from a flowering plant represents a coding sequence substantially similar to the Seq ID. NO: 5 in both protein sequence and protein function.
A "BP" gene may or may not include the 5' and 3' regions normally 25 associated with said coding sequence, as a native "BP" gene will include at least functional portion of these regulatory regions, whereas a recombinant "BP"
gene will have at least one portion of the 3' or 5' regions altered by the addition of new DNA sequences. The alteration of the 5' or 3' regions of said BP gene will be at least expected to cause altered expression in the native plant species from which the BP gene was derived when compared to the expression of the wt BP
gene normally found in said plant species.
In one embodiment of the present invention, the expression of the BP
gene in a plant species is altered by the inhibition of expression of the native BP
gene coding sequence. Accordingly, it is one object of the present invention to alter the expression levels of the protein encoded by the BP gene normally found in a plant species by introduction of a recombinant BP gene~that alters the expression of the wt BP gene by reduction of the native BP gene expression and reduction of the levels of the protein encoded by the wt BP gene in said plant species.
It is a further embodiment of the present invention to alter the expression of a wt BP gene in a plant species by introduction of a recombinant version of said BP gene, said recombinant version altered by the addition of one of more DNA sequences that lead to the increased expression of said gene relative to the expression of the wt BP gene in said plant species, leading to the increased expression levels of the protein encoded by a wt BP gene coding sequence in said plant species.
It is still another embodiment of the present invention to express a non-native BP coding sequence in a plant species. Said non-native BP coding sequence can be an altered form of the BP coding region normally found in said plant species, or a BP functional homologue from a different plant species.
Expression of the non-native BP protein can be expected to alter the activity of the native BP protein by competition for DNA binding regions, or the non-native BP protein can encode an activity that provides a phenotypic distinction.
Accordingly, it is one embodiment of the present invention to alter the activity of the protein encoded by the BP gene normally found in a plant species is altered by introduction of a recombinant version of a non-native BP gene, said recombinant version altered by the addition of one of more DNA sequences that lead to expression of said gene in said plant species, leading to altered activity of the native BP protein. In the present case, altered activity of the BP protein is defined as changes in the inflorescence structure in plants that comprise the non-native BP gene.
Similarly, in a further embodiment of the present invention to alter the expression of a wt BP gene in a plant species by introduction of a recombinant non-native BP gene that alters the activity of the wt BP gene by reduction of the native BP gene expression and reduction of the expression of the protein encoded by the wt BP gene in said plant species.
The identification of this unique genetic activity and specific function allows for novel strategies to manipulate plant morphology or architecture.
The sequence can also be used to isolate corresponding related similar or identical sequences from other plant species. Related techniques are well understood in the art, for example as provided in Sambrook et al., Moleeula~ Clohing: A
Labof°atory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y.(1989).
The applications of this gene for engineering useful flower/inflorescence architectures in crop and economically important plant species include both the production of more compact flowering structures and conversely methods for the genetic reprogramming of inflorescence structure to produce less compact and more spreading floral structures useful for horticultural applications.
One preferred application is to develop a by phenotype in canola crop species (e.g. Bf~assica napus, B. rapa). A compact inflorescence architecture in canola will offer several advantages to this crop that may include reduced shattering and improved overall performance. As one aspect of the present invention, BP-related genes from canola have been isolated and are used to engineer by -phenotypes.
Similar strategies can be applied to other crop plants by using BP
functional homologues from the respective species. Engineering novel and useful architectures using BP or functional homologues is not limited to crop species; potential applications could be extended to horticultural plants to create aesthetically appealing flowers or inflorescences.
Accordingly, in one embodiment of the invention the subject method includes the steps of expressing a BP gene in a plant species comprising the steps of:
a) Introducing into a plant cell capable of being transformed a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in said cells, a DNA sequence derived from a KNATI gene, for example, that encodes a peptide having at least 50% homology to the peptide encoded bySEQ ID NO: 5, operably linked to a suitable transcriptional regulatory region and, b) recovery of a plant which contains said recombinant DNA, said plant exhibiting altered inflorescence architecture.
The suitable transcriptional regulatory region can be the regulatory region normally associated with the KNATl gene or BP coding sequence or a heterologous transcriptional regulatory region capable of expression in the inflorescence.
In another preferred embodiment of the invention the subject method includes a method for modifying the inflorescence architecture of a plant comprising:
(a) Introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA
sequences required for transformation and selection in plant cells, a DNA sequence that comprises a polynucleotide region derived from SEQ ID. NO: 5 or 6 encoding a BP gene sequence or part thereof, operably linked to a suitable transcriptional regulatory region and, (b) recovery of a plant which contains said recombinant DNA and has altered inflorescence architecture.
The chimeric gene is introduced into a plant cell and a plant cell recovered wherein said gene is integrated into the plant chromosome. The plant cell is induced to regenerate and a whole plant is recovered with altered inflorescence architecture.
The method further relies on the use of transformation to introduce the 5 gene encoding the enzyme into plant cells. Transformation of the plant cell can be accomplished by a variety of different means. Methods that have general utility include Agnobactez°iuzzz based systems, using either binary and cointegrate plasmids of both A. tuzzzifaciezzs and A. rhyzogenies. (e.g., US 4,940,838, US
5,464,763), the biolistic approach (e.g, US 4,945,050, US 5,015,580, US
10 5,149,655), microinjection, (e.g., US 4,743,548), direct DNA uptake by protoplasts, (e.g., US 5,231,019, US 5,453,367) or needle-like whiskers (e.g., US 5,302,523). Any method for the introduction of foreign DNA and/or genetic transformation of a plant cell may be used within the context of the present invention.
It is also apparent to one skilled in the art that the polynucleotide and deduced amino acid sequence of SEQ ID. NO: 5 or 6 can be used to isolate related genes from various other plant species. The similarity or identity of two polypeptide or polynucleotide sequences is determined by comparing sequences.
In the art, this is typically accomplished by alignment of the amino acid or nucleotide sequences and observing the strings of residues that match. The identity or similarity of sequences can be calculated by known means including, but not limited to, those described in Computational Molecular Biology, Lesk A.M., ed., Oxford University Press, New York, 1988, Biocomputin~:
Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993., Computer Analysis of Sequence Data, Part I, Griffin, A.M. and Griffin, H.G., eds., Humana Press, New Jersey, 1994 and other protocols known to those skilled in the art. Moreover, programs to determine relatedness or identity are codified in publicly available programs. One of the most popular programs comprises a suite of BLAST programs, three designed for nucleic acid sequences (BLASTN, BLASTX and TBLASTX), and two designed for protein sequences (BLASTP and TBLASTN) (Coulson, Trends in Biotechnology, 12:76-80, 1994). The BLASTX program is publicly available from NCBI and other sources such as the BLAST Manual, Altschul, S., et al., NCBI NLM NIH
Bethesda Maryland 20984, also http://www.ncbi.nlm.nih.govBLAST/blast help.html) provides online help and further literature references for BLAST and related protein analysis methods, and Altschul, S., et al., J. Mol. Biol 215:403-410, 1990.
Within the BP gene two regions are found, the homeodomain and the ELK region. Within the homeodomain region BP shares significant homology with number of other homeodomain proteins (approximately 50 in A~abidopsis), and also other plant and animal homeodomain proteins, thus the BP protein represents one of the many homeobox genes.
The isolated polynucleotide can be sequenced and the DNA sequence used to further screen DNA sequence collections to identify related sequences from other species. The DNA sequence collections can comprise EST sequences, genomic sequences or complete cDNA sequences.
In Arabidopsis the entire BP coding sequence shares the highest homology with STM which is implicated in meristem maintenance and function(41%), whereas outside ofA~abidopsis, it shares 53% homology with maize RSI and 52% with rice OSH15. These genes have been identified by utilizing the conserved domains of plant homeobox genes. Similarly, hybridization can be used to isolate BP functional homologues genes from other species. In the present invention, we have used probes derived from SEQ ID
NO: 5 to isolate cDNA sequences homologous to the BP gene of Ai°abidopsis.
The present inventors have isolated BP genes from BYassica aapus, B. oleracea and B. t°apa using hybridization. These Br-assica BP genes have been incorporated into plant transformation vectors and have been used to transform plants to obtain plants with altered inflorescence structures.
Accordingly, in one embodiment of the invention the subject method for modifying the inflorescence of a plant comprising the steps of a.) Introducing into a plant cell capable of being transformed a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in said cells, a DNA sequence that encodes a BP coding sequence encoding a peptide having of at least 50% sequence identity to the peptide encoded by SEQ ID.
NO: 5, operably linked to a suitable transcriptional regulatory region and;
b.) recovery of a plant which contains said recombinant DNA.
In another embodiment of the present invention, alteration of Brassica inflorescence structure is contemplated. Accordingly, the present invention encompasses a method for modifying the inflorescence of a Brassica plant comprising the steps of a.) Introducing into a Brassica plant cell capable of being transformed a genetic construct comprising a first DNA
expression cassette that comprises, in addition to the DNA
sequences required for transformation and selection in said cells, a DNA sequence that encodes a Brassica BP coding sequence encoding a protein of at least 50% sequence identity to the protein sequence encoded by SEQ ID. NO: 5, operably linked to a suitable transcriptional regulatory region and, b.) recovery of a Brassica plant which contains said recombinant DNA and exhibits an altered inflorescence.
The use of gene inhibition technologies such as antisense RNA or co-suppression or double stranded RNA interference is within the scope of the present invention. In these approaches, the isolated gene sequence is operably linked to a suitable regulatory element.
Accordingly, in one embodiment of the invention the subject method includes a method to modify the inflorescence of a plant comprising the steps of:
a.) Introducing into a plant cell capable of being transformed a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in said cells, a DNA sequence that encodes a BP coding sequence encoding a protein of at least 50%
sequence identity to the protein encoded by SEQ ID. NO: 5, at least a portion of said DNA sequence in an antisense orientation relative to the normal presentation to the transcriptional regulatory region, operably linked to a suitable transcriptional regulatory region such that said recombinant DNA construct expresses an antisense RNA or portion thereof of an antisense RNA and, b.) recovery of a plant which contains said recombinant DNA.
It is apparent to the skilled artisan that the polynucleotide encoding the sequence can be in the antisense (for inhibition by antisense RNA) or sense (for inhibition by co-suppression) orientation, relative to the transcriptional regulatory region, or a combination of sense and antisense RNA, to induce double stranded RNA interference (Chuang and Meyerowitz, PNAS 97: 4955-4990, 2000, Smith et al., Nature 407: 319 - 320, 2000).
A transcriptional regulatory region is often referred to as a promoter region and there are numerous promoters that can be used within the scope of the present invention. In addition, the skilled artisan will readily recognize that the sequence of the inserted recombinant gene must contain regions of sufficient homology to allow for sequence-specific inhibition of gene expression.
Another application for the BP gene is as a visible marker for plant transformation. The advantages of using selection systems that do not include antibiotic/herbicide resistance marker genes for producing transgenic plants are well recognized. Since the bp-1 null mutant represents a phenotype that is clearly visible and easily distinguishable from wild type plants, it is possible to develop transformation vectors based on the BP gene that are devoid of any antibiotic or herbicide selection markers to provide a novel and very efficient alternative to the currently available selection systems. As evidenced by the present invention, the use of the BP gene for complementation of the by phenotype in Arabidopsis demonstrates the it is possible to select for plants that have received a BP gene as a result of transformation with said gene.
5 It is apparent to the skilled practitioner that any number of methods for the construction of a heterologous genetic construct encoding the protein or portion thereof encoded by SEQ ID. NO: 5 or homologues thereof can be used to alter the architecture of plant wherein said DNA construct has been introduced.
The following examples serve to illustrate the method and in no way limit the utility of the invention.
Example 1: Construction and Analysis of Arabidopsis by Mutant Lines.
Plant material and genetic analysis. Plants were grown at 22°C (90%
relative humidity) under fluorescent and incandescent light at ~60 ~.E/m 2 /s with 16 h days. The by mutant seeds were obtained from the Arabidopsis Biological Resources Center (ABRC), Ohio State University (stock number CS30;
(Koornneef, M., Eden, J. v., Hanhart, C. J., Stam, P., Braaksma, F. J. &
Feenstra, W. J. (1983) J. Hered. 74, 265-272.)). This allele was designated bp-1.
A second by allele (bp-2) was isolated from promoter-tagged Af~abidopsis lines in RLD background. This allele was introgressed into Ler and backcrossed five times with wild type (wt). bp-2 was introduced into Columbia (Col) wt background from Ler and backcrossed three times.
Histology. Plant samples were fixed for 24 h at room temperature in FAA and paraffin embedded as described (Johansen, D. A. (1940) Plant nzicrotechfZigue (McGraw-Hill Book Co., New York).). Serial sections were taken at 8 ~m on a rotary microtome, attached to glass slides with Mayer's egg albumin (Sigma) solution, and dried on a warming tray (42°C). Sections were stained after removal of the embedding medium in toluidine blue O. The sections were observed under a Leitz (Wetzlar) microscope and images were captured using Optronics DEI 750 digital microscope camera.
Scanning electron microscopy For scanning electron microscopy (SEM) the samples were fixed in 3% glutaraldehyde and processed as described (Venglat, S. P. & Sawhney, V. I~. (1996) Planta 1968, 480-487.). Samples were mounted on aluminum stubs and coated with gold in an Edwards S150B sputter-coater.
Observations were made with a Phillips SEM 505 scanning electron microscope at 30 kV and recorded using Polaroid type 665 P/N. Images were scanned and enhanced using Adobe Photoshop 4Ø
Architectural Changes in the infloresence of by mutants. In all by plants the earliest signs of alteration of the inflorescence are evident at the time of bolting, with more compactly arranged floral buds at the apex; the effects were more pronounced when the first few co-florescence internodes from the rosette leaves started elongating. At maturity, by plants display a marked reduction in overall height, primarily as a result of shortened internodes; moreover, the floral internodes were affected to a greater extent than the co-florescence internodes (Fig. 1,2). Additionally, bending at nodes was observed and this phenotype was more severe in bp-1 than bp-2 plants. bp-2 in RLD (the original isolate) and Col backgrounds showed similar patterns, although the reduction in internodal lengths was less than observed in Ler background. by affects cell division and cell differentiation in the internodes of the inflorescence. SEM analysis showed that the floral buds began pointing downwards quite early in their development and that the internodal elongation is significantly reduced. The peduncle surface showed stripes consisting of cell files (~15 cells in width) with changes in epidermal cell differentiation (defined by alterations in by lines in cell size, shape, and/or cell type (stomata) in relation to similar regions in wt) associated with regions below the nodes (Fig. 3). Cross sections through internodes in by indicated that the overall radial pattern, in terms of tissue types, was very similar to the wt (Fig. 3). However, small sectors with changes in epidermal cell differentiation are observed, and these corresponded to the stripes of differentiation-altered cells observed by SEM. Furthermore, the cortical cells below these sectors Were had changes in differentiation (indicated by a lack of chloroplasts), and the cells were relatively larger with less intercellular space.
Longitudinal sections through the nodes showed sectors of epidermal and sub-epidermal changes. As the cell number per unit area along the main axis of the peduncle in BP was comparable to the wt, the reduced internodal length was interpreted to be .a result of fewer cell divisions.
BP causes changes in inflorescence development. Pedicels in by plants at all the floral nodes showed a drastic reduction in length compared with wt (Fig. 2), in addition to downward-pointing siliques (Fig. 1). The degree of the latter phenotype conferred by bp-2 varied in different backgrounds from downward pointing (Ler) to less acute bending in RLD and Col backgrounds. Since very little is known about pedicel development in any plant species, including Af~abidopsis, we determined its ontogeny in Ler wt compared with bp. Pedicel initiation was first observed around stage 3 flowers, followed by elaboration of the pedicel with coordinated development on both the abaxial and adaxial sides, and along the proximo-distal axis. The first signs of epidermal differentiation (defined by characteristic changes in cell shape and the appearance of stomata) were observed on the abaxial side at stage 9, and this was closely followed by differentiation on the adaxial side in subsequent stages. By stage 12 epidermal cell differentiation was completed with no apparent differences observed between the abaxial and adaxial sides in the wt (Fig. 4). In bp, no detectable differences from wt were observed up to stage 3. However, the pedicel differentiation and elaboration processes lagged behind the wt and the first sign of epidermal cell differentiation was observed only at stage 12, and this was restricted to the adaxial surface; no corresponding differentiation was observed' on the abaxial side, even by the mature stage (Fig. 4). Anatomical analysis showed that while the major part of the pedicel in by contained defects in the differentiation of abaxial-side epidermal cells and cortical cells (Fig. 4), the distal region including the receptacle was more strongly affected with a significantly reduced pith region, cell size and differentiation, and radial growth (Fig. 4). Longitudinal sections through the pedicels also showed that the cells in the epidermal layer and cortical tissues on the abaxial side were less elongated (Fig. 3). Furthermore, there were fewer cells in the proximo-distal axis of the pedicel, indicative of fewer cell divisions. Although there were no apparent defects observed in the sepals, petals, and stamens, the carpels showed detectable differences in bp. Notably, there was reduced radial growth of the style (Fig. 5), although there was variability observed between plants regarding this phenotype. The epidermal and cortical cells of the style, especially in the lateral axis, were defective in differentiation and elongation, and as a consequence the arrangement of stigmatic papillae was significantly altered (Fig. 5). These observations support a functional role for BP in maintaining the normal growth and radial symmetry of the style. The developmental and anatomical studies suggested that the defects in by were only associated with the peduncle and parts of the flower but not with the leaves.
Example 2: Isolation of the KNATI coding sequence.
To isolate the KNATI coding sequence, cDNA cloning was used.
Reverse transcription was carried out using 3-5 ~.g of total RNA from stem tissue of wt (Col, Ler, RLD) and by plants and Superscript II RT (Life Technologies). To amplify the KNATl open reading frame (ORF), 1 ~1 of cDNA
was used for PCR with primers Seq ID NO: 1 954 DNA SEQ 5' cgggatccatggaagaataccagcatgac 3' and SEQ Id NO: 2 .20 955 DNA SEQ 5' cgggatccggtacctggatgtcttatggaccgag 3' and Pfu polymerase (1U). Amplification of the cytosolic glyceraldehyde-3-phosphate dehydrogenase (gapC) cDNA (Shih, M.-C., Heinrich, P. C. ~
Goodman, H. M. (1991) Gefae 104, 133-138.) from the same cDNA pools was performed under the same conditions Seq ID NO: 3 DNA SEQ gapC-UP 5' accactaactgccttgctc 3' 5 and SEQ ID NO: 4 DNA SEQ gapC-DN 5' caatttcacaaacttgtcgctc 3' IO
I~NAT1-encoding PCR products were cloned and sequenced by primer walking using an ABI 377 DNA sequencer. The sequence of the wt KNATl gene is shown in Seq ID NO: 5.
15 Example 3: Expression of BP genes.
Based on the discovery that BP represents the previously described KNAT1 gene, probes for KNAT1 were generated as described above and used to analyzed BP transcript levels in col wt and Ler wt by northern blots and by 20 the more sensitive RT-PCR. Results from these experiments showed 2-4 times higher transcript levels in col wt ecotype (data not shown).
Example 4: Isolation of BP genomic regions.
25 The BP appears to be expressed predominantly in stem and pedicel tissues in wt plants. To clone BP, a region between I~ETI and the centromere on chromosome 4 was chosen, based on genetic maps compiled from several data sets (http:llwww.Ar-abidopsis.org; (Pepper, A., Delaney, T., Washburn, T., Poole, D. & Chory, J. ( 1994) Cell 78.)). To produce probes reflecting the anticipated expression pattern of BP, polyA + RNA was isolated from both stem/pedicel and leaf tissues in Col wt plants and a Suppression subtractive hybridization (SSH) was performed using leaf cDNA as driver. Total RNA was harvested from stem/pedicel and leaf tissues of Col wt using Trizol Reagent (Life Technologies). Poly A + RNA was isolated using mRNA spin columns (Clontech). cDNA synthesis was carried out using a cDNA synthesis kit (Life Technologies). A total of 2 ~g each of leaf cDNA (driver) and stem/pedicel cDNA (tester) was digested with HaeIII (New England Biolabs) and used for suppression subtractive hybridization as described (Diatchenko, L., et al. (1996) Proc. Natl. Acad. Sci. USA 93, 6025-6030.). The subtracted mix was 32 P-labeled using a RediPrime kit (AP Biotech) and used to screen Bacterial Artificial Chromosome (BAC) DNA preparations as described below.
BAC clones from chromosome 4 were obtained from the ABRC. DNA
was prepared from 10-ml cultures of BACs T17A2, T13D4, F9M13, T12G3, T28D5, TISF16, T3F12, T32A17, T3H13, F23J3, T8A17, T30A10, T1~G18, T25P22, and T24H23 using an alkaline lysis miniprep method (Ausubel, F. M., Brent, R., Kingston, R. E., Moore, D. D., Seidman, J. G., Smit, J. A. &
Struhl, K. (1995), (John Wiley and Sons, Inc., New York).). BAC DNA was digested with BamHI, EcoRI, or HindIII (Life Technologies), fractionated on a 0.8%
agarose gel, then blotted to a Zeta Probe membrane (BioRad) using standard procedures as described (Ausubel, et al, ibid.) The blot was probed with the pooled subtracted mix representing cDNAs expressed in stem/pedicel tissue, prepared as described above. Genomic DNA (5 fig) isolated from leaves (Dellaporta, S. (1994) in The Maize HafZdboolc, eds. Freeling, M. & Walbot, V.
(Springer-Verlag, New York), pp. 522-525.) of wt and by plants was digested using 30 U BanaHI or EcoRI (Life Technologies) at 37°C for 8 hours, processed as above, and probed with the 32 P-labeled KNATI RT-PCR product from Col wt. Hybridization proceeded for 3 h (BAC screen) or overnight (genomic Southern blot) at 65°C in QuickHyb hybridization solution (Stratagene); the most stringent wash was in O.lx SSC/0.1% SDS at 65°C. The blots were exposed to X-GMAT AR film (Kodak) overnight at -70°C. PCR, RT-PCR, and DNA sequencing.
The pooled subtracted products were then used as a probe in a Southern blot with 15 BACs as targets spanning a region of approximately 1.5 Mb on chromosome 4 between Z)ETI and the centromere. A BamHI fragment of about kb from BAC F9M13 was the only band that showed any hybridization to the 15 subtracted probe. BAC F9M13 (GenBank AC006267) contains a single gene on this 20-kb BamHI fragment within a region rich in repeats. Subsequent fingerprinting of F9M13 with this probe confirmed that the probe detected the previously reported homeobox gene KNATl.
20 Example 5: Determination of BP gene coding sequence in by mutant and wild type lines.
It was found that the bp-1 mutant represented a deletion of the BP gene.
To identify the molecular basis for the bp-2 mutant phenotype, BP-encoding RT-PCR products from duplicate reverse transcription reactions using L. er (wt), RLD (wt), bp-2 (col), bp-2 (Ler), and bp-2 (RLD) were then cloned and their sequences determined. It was found that the bp-2 lines contained an altered protein coding sequence which has a C-T transition corresponding to position 535 of the col (wt) ORF. This is shown in SEQ ID NO: 6, the bp-2 coding region. This point mutation changed codon 179 from cag to tag, thereby introducing a stop codon and resulting in a truncated predicted protein sequence shown in SEQ ID NO: 7.
This sequence analysis further demonstrated that in wt Ler and RLD the BP
ORFs encoded predicted proteins of 400 aa, compared with a predicted protein of 398 as for col wt.
Example 6: Complementation of by mutant lines In order to demonstrate the function of the ~KNATI gene in the by phenotype, plants exhibiting a by phenotype were transformed with a wild-type 1 S KNATI gene under the control of the native BP (KNATI ) promoter. Two different complementation constructs were prepared. The structure of the vectors used for complementation of the by phenotype in Ai°abidopsis thaliana is as follows:
The backbone for both vectors was pRD400 (Datla, R. S. S., J. K.
Hammerlindl, B. Panchuk, L. E. Pelcher, and W. Kelley. 1992. Modified binary plant transformation vectors with the wild-type gene encoding NPTII. Gene 122:383-384). This vector was used to derive two plant transformation vectors.
In both constructs, the BamHI sites at the junction of the promoter and ORF
were introduced to facilitate assembly of the constructs. B, BanZHI; Bg, BgIII, K, KpnI. Parentheses indicate sites destroyed by ligation.
Construct A. Referred to as pRD400-951/955, consisting of the KNATl cDNA (SEQ ID NO: 5) cloned downstream of the putative KNATl promoter as shown in figure 8. The KNATI promoter was isolated by PCR using the .
following primers:
SEQ ID NO: 8 5'cccaagcttagatctttcggtctagtgcagtgatg 3' and Sequence ID NO: 9 5' ccggatcccagatgagtaaagatttg 3' for amplification of the putative KNATI promoter; 1536 by product corresponding to the region immediately upstream of the KNATI start codon.
Amplification conditions for all primers using genomic DNA as template were as follows: 94°C, 2 min followed by 30 cycles of 94°C, 15 sec;
55°C, 30 sec;
and 72°C, 4-6 min. A final extension of 10 min at 72°C was performed. All amplifications from genomic DNA used Pfu polymerase (Stratagene) (2.5 U) and a PTC-200 thermal cycler (MJ Research).
Construct B. Referred to as pRD400-951/956, consisting of the putative KNATl promoter and the KNATI -encoding ORF amplified from genomic DNA.
To amplify the KlVATl coding region, two primers were used, Seq ID NO: 1 (as described in example 2), and SEQ ID NO: 10 IO . 5' gaagatctgtcgacgccttgtgcttgattgagactcca 3' for amplification of the protein coding region and terminator from genomic DNA; 3347-by product from the KNATl start codon to a point 705 by downstream of the stop codon, including the putative transcriptional terminator.
Agrobacteriurrz tunZefaciefzs GV3101 containing these recombinant constructs were used to transform bp-2 (Ler) plants by vacuum infiltration (Bechtold, N., Ellis, J. & Pelletier, G. (1993) C.R. Aead. Sei. Ser. 11I316, 1199.). Transformation of bp-2 (Ler) with the genomic clone of KNATI resulted in 20 transformants; 4 were completely rescued to wt, while the others were partially rescued. Southern analysis confirmed that these complemented lines contained the KNATI wt transgene. Further analysis of two of these single transgene copy lines showed a 3:1 (wt:bp) segregation pattern in the T2 generation, providing genetic confirmation of complementation.
Complementation of BP with KNATI cDNA was also observed.
Example 7: Overexpression of the Arabidopsis BP gene.
In this example, the native Arabidopsis BP gene (wt K1VAT1 ) was used for over expression. The BP gene coding region (SEQ ID. NO: 5) was used to make an over expression construct with enhanced 35S promoter referred to as pRD400-35S::AtbpS, consisting of the A. thaliana BP ORF under the control of the 35S promoter assembled using routine methods. This vector is shown in Figure 10. The vector was used to transform Arabidopsis as above.
Example 8: Expression of the Arabidopsis BP gene in heterologous species The vector pRD400-35S::AtBPS was used to transform B. napus. The vector was inserted into Agrobacterimn stain MP90 by standard triparental mating followed by Ags°obacteriunz-mediated transformation of Brassica.
Transformation was essentially carried out as described by Moloney et al., Plant Cell Reports 8:238-242, 1989.
Example 9: Construction of antisense Arabidopsis BP genes The BP coding region was used to construct an antisense construct under its own promoter (l.Skb) and also the 35S promoter. For expression of antisense RNA under the 35S promoter, the vector pRD400-35S::AtBPA/S, consisting of the A. thaliana by ORF in an antisense orientation under the control of the promoter was constructed and is shown in Figure 11.
For expression of antisense RNA under the KNATI promoter, the vector pRD400-951 /952::AtbpA/S, consisting of the A. thaliana by cDNA (nucleotides 481-1227) in an antisense orientation under the control of the A. thaliana KNATl promoter was constructed and is shown in Figure 12.
Teens used: Nos Ter, Nos terminator. B, Baf~zHI; Bg, BgIII, I~, KpfZI; H, HirzdIII, S, SstI.
Example 10: Expression of an altered Arabidopsis BP gene In this example, the protein encoded by SEQ ID NO: 6 was expressed under its own promoter (l.Skb) and also the 35S promoter.
For expression of the altered BP gene under the 35S promoter, the vector pRD400-35S::Atbp-2, consisting of the A. thaliana bp-2 ORF under the control of the 35S promoter is constructed using the same procedures as for the wild-I S type coding sequence and is shown in Figure 12.
For expression of the altered BP gene under the KNATI promoter, the vector pRD400-951/952::Atbp-2, consisting of the A. thaliana bp-~ cDNA
(nucleotides 481-1227) in an antisense orientation under the control of the A.
tJZaliana KNATI promoter is constructed as above and is shown in Figure 13.
Example 11: Isolation of BP related coding sequences from other species: B.
yiapus The A. thalia~za KNATl (BP) cDNA isolated in example 2 was used to screen a cDNA library prepared from stem tissues of B. ~capus. A total of 200,000 pfu were initially screened under moderate stringency hybridization conditions (hybridization solution contained 30% fonnamide/5x SSC/5x Denhardt's solution/0.5% SDS/50 ~g/mI salmon sperm DNA at 42°C, with final washes in O.lx SSC/0.1% SDS at 55°C). 13 plaques were purified from these primary screens; these were excised from their phagemid hosts and sequenced.
BLAST analysis showed that the clones fell into 3 groups: nonspecific I O clones (discarded); homeobox gene-Like sequences that were not likely orthologs ofA. thaliana Knatl; and apparent Knatl orthologs. The latter group was represented xhe most frequent and consisted of both full-length and 5' truncated clones. The complete sequence on both strands was determined for the longest cDNA isolated from these screens (1515 bp), which was designated the name Bnbp.
This cDNA contained an ORF of 1158 by with 73 nucleotides of 5' untranslated region (UTR) and 284 nucleotides of 3' UTR and is shown in SEQ
ID NO: 11. The predicted protein encoded by this cDNA was 385 amino acids in length and showed 86.3% similarity (PAM250 residue weight table) to A.
thaliana bp.
PCR primers SEQ ID NO: 12: 5'-cgggatccatggaagaatatcaacatgaa-3' SEQ ID NO: 13: 5'-cgggatccggtaccttatggtccaagacgat-3' were designed to amplify the ORF from this cDNA with ends modified with Bdn2HIlNcoI (5' end) and BarnHIlKpnI (3' end) to facilitate its insertion into the expression constructs described above. The Bnbp ORF was amplified from the cDNA isolated from the library screens with Pfu polymerase (Stratagene) and cloned into a standard PCR product cloning vector (pCR2.l;
Invitrogen).
Example 12: Isolation of BP related coding sequences from other species: B.
papa, B. olenacea The PCR primers that were designed to amplify the Bnbp ORF were used to isolate by orthologs from species closely related to B. faapus. Total RNA
was extracted from B. s°apa and B. oleracea (kale) hypocotyls harvested 6 days after germination and used as a template for first strand cDNA synthesis with Superscript II reverse transcriptase (Life Technologies). This eDNA was then used as a PCR template to amplify bp-like cDNAs from these species. PCR
products were cloned into a standard vector (pCR2.1) and their sequences determined by primer walking. The sequences are shown in Seq ID Nos. 14 and 15.
Example 13: Isolation of BP related genes from other species: B. r~apa, B.
oleracea Isolation of genomic clones encoding BP from B. napus, B. s°apa, and B.
oleracea. Using the sequences of the by cDNAs determined as described above, PCR primers were designed to amplify the genomic copies (including introns) of the BP genes from each species (B. napus, B. f°apa, B. oleracea). The primers 5 used were:
Seq ID NO: 16: PCR Primer used to amplify B. napus BP from genomic DNA
5'-ataacaccaccaccaacaac-3' Seq ID NO: 17: PCR Primer used to amplify B. napus BP from genomic DNA
5'-actaggaagtctcaaacccc-3' Seq ID NO: 18: PCR Primer used to amplify B. rapa, B. oleracea B.P from genomic DNA .
5'-tcaacatgaaagcagatccac-3' Seq ID NO: 19: PCR Primer used to amplify B. f°apa, B. oleracea BP
from genomic DNA
5'-aacgagagaggcaacaaaag-3' The PCR products (approximately 3.8 kb for each species) were cloned into pCR2.1 and their sequences were determined by primer walking.
The sequence of the B. raapus by genomic region isolated using primers as described in Seq ID nos. 16 and 17 is shown in SEQ ID NO: 20 The sequence analysis revealed that the B. napus BP coding region, like that of A. thaliafza BP, is interrupted by 4 introns. The positions and relative lengths of the introns were all similar to the A. thaliana BP gene.
Example 14: Isolation of BP promoter regions from B. napus Isolation of sequences upstream of B. fzapus BP, including the probable promoter. The sequence of the BP-encoding cDNA from B. hapus was used to design primers to isolate 5' regions of the by gene. Primers used were:
SEQ ID NO: 21: PCR Primer used to amplify the region upstream of the by gene from B. aapus 5'-catgatcggatcggaagcaattctcagtcg-3' SEQ ID NO: 22: PCR Primer used to amplify the region upstream of the by gene from B. hapus 5'-aaaagttgagagagaaagagagagagagag-3' to isolate the putative promoter-containing region from genomic DNA.
For this purpose, a Genome Walker kit (Clontech) was used. Following the standard protocols in the kit, two fragments (840 and 950 bp) were isolated that represent the likely promoters of the two BP genes of B. napus. The sequences are presented in SEQ ID Nos. 23 and 24.
Example 15: Construction of a vector comprising the Br~assica BP gene under the control of an A~~abidopsis promoter.
The map of the vector of pRD400-951 /952::BnBPS, consisting of the B.
napus BP ORF (SEQ ID. NO: 11 ) under the control of the A. thaliana KNATI
promoter constructed using standard techniques is shown in figure 14. The vector was used to transform Arabidopsis and Brassica napus as described.
Example 16: Construction of a vector comprising the Bnassica BP gene under the control of a constitutive promoter.
The vector map of pRD400-35S::BnBPS, consisting of the B. napus BP
ORF (Seq ID NO: 11) under the control of an optimized cauliflower mosaic virus (CaMV) 35S promoter (Datla, R. S. S., F. Bekkaoui, J. K. Hammerlindl, G. Pilate, D. I. Dunstan, and W. L. Crosby. 1993. Improved high-level constitutive foreign gene expression in plants using an AMV RNA4 untranslated leader sequence. Plant Sci. 94:139-149) is shown in figure 15. The vector was assembled using well-known techniques as described. The vector was used to transform Arabidopsis and Bf-assica rZapus as described herein.
Example I7: Construction of a vector comprising a B~~assica antisense BP
gene under the control of a constitutive promoter.
The vector map pRD400-35S::BnbpA/S, consisting of the B. napes BP
ORF in an antisense orientation under the control of the 35S promoter is shown in figure 16. The vector was assembled using well-known techniques as described. The vector was used to transform A~abidopsis and Brassica napes as described herein.
Sequence listing free text SEQ ID NO: 1 954 DNA SEQ - PCR primer SEQ ID NO: 2 955 DNA SEQ - PCR primer SEQ ID NO: DNA SEQ gapC-UP - PCR primer SEQ ID NO: 4 DNA SEQ gapC-DN .
SEQ ID NO: 8 DNA SEQ 951 - PCR primer SEQ ID NO: 9 DNA SEQ 952 - PCR primer SEQ ID NO: 10 DNA SEQ 956 - PCR primer SEQ ID NO: PCR primer SEQ ID NO: 13 PCR primer SEQ ID NO: 16 PCR primer SEQ ID NO: 17 PCR primer SEQ ID NO: 18 PCR primer SEQ ID NO: PCR primer SEQ ID NO: 21 PCR primer SEQ ID NO: 22 PCR primer Sequence ID listing Seq ID NO: 1 954 DNA SEQ (Synthetic DNA) 5' cgggatccatggaagaataccagcatgac 3' SEQ Id NO: 2 955 DNA SEQ (Synthetic DNA) 5' cgggatccggtacctggatgtcttatggaccgag 3' Seq ID NO: 3 DNA SEQ gapC-UP (Synthetic DNA) 5' accactaactgccttgctc 3' SEQ ID NO: 4 DNA SEQ gapC-DN (Synthetic DNA) 5' caatttcacaaacttgtcgctc 3' 15' Seq ID NO: 5 KNAT 1 gene (cDNA Sequence) 5'cgggatccatggaagaataccagcatgacaacagcaccactcctcaaagagtaagtttcttgtactctccaatct cttcttccaacaaaaacgataacacaagtgataccaacaacaacaacaacaataataatagtagcaattatggtcct ggttacaataatactaacaacaacaatcatcaccaccaacacatgttgtttccacatatgagctctcttctccctcaaa c aaccgagaattgcttccgatctgatcatgatcaacccaacaacaacaacaacccatctgttaaatctgaagctagctc ctcaagaatcaatcattactccatgttaatgagagccatccacaatactcaagaagctaacaacaacaacaatgaca acgtaagcgatgttgaagccatgaaggctaaaatcattgctcatcctcactactctaccctcctacaagcttacttgga ctgccaaaagattggagctccacctgatgtggttgatagaattacggcggcacggcaagactttgaggctcgacaa cagcggtcaacaccgtctgtctctgcctcctctagagacccggagttagatcaattcatggaagcatactgtgacat gttggttaaatatcgtgaggagctaacaaggcccattcaggaagcaatggagtttatacgtcgtattgaatctcagctt agcatgttgtgtcagagtcccattcacatcctcaacaatcctgatgggaagagtgacaatatgggatcatcagacga agaacaagagaataacagcggaggggaaacagaattaccggaaatagacccgagggccgaagatcgggaact caagaaccatttgctgaagaagtatagtggatacttaagcagtttgaagcaagaactatccaagaagaaaaagaaa ggtaaacttcctaaagaagcacggcagaagcttctcacgtggtgggagttgcattacaagtggccatatccttctga gtcagagaaggtagcgttggcggaatcaacggggttagatcagaaacaaatcaacaattggttcataaaccaaag aaagcgtcactggaaaccatctgaagacatgcagttcatggtgatggatggtctgcagcacccgcaccacgcagc tctgtacatggatggtcattacatgggtgatggaccttatcgtctcggtccataagacatccaggtaccggatcccg 3' SEQ ID NO: 6, the bp-2 coding region (cDNA Sequence) 5'cgggatccatggaagaataccagcatgacaacagctccactcctcaaagagtaagtttcttgtactctccaatctc ttcttccaacaaaaacgataacacaagtgataccaacaacaacaacaacaataataatagtagcaattatggtcctg gttacaataatactaacaacaacaatcatcaccaccaacacatgttgtttccacatatgagctctcttctccctcaaac a accgagaattgcttccgatccgatcatgatcaacccaacaacaacccatctgttaaatctgaagctagctcctcaag aatcaatcattactccatgttaatgagagccatccacaatactcaagaagctaacaacaacaacaatgataacgtaa gcgatgttgaagccatgaaggctaaaatcattgctcatcctcactactctaccctcctacaagcttacttggactgcca aaagattggagctccacctgacgtggttgatagaattacggcggcacggcaagactttgaggctcgacaatagcg gtcaacaccgtctgtctctgcctcctctagagacccggagttagatcaattcatggaagcatactgtgacatgttggtt aaatatcgtgaggagctaacaaggcccattcaggaagcaatggagtttatacgtcgtattgaatctcagcttagcatg ttgtgtcagagtcccattcacatcctcaacaatcctgatgggaagagtgacaatatgggatcatcagacgaagaaca agagaataacagcggaggggaaacagaattaccggaaatagacccgagggccgaagatcgggaactcaagaa ccatttgctgaagaagtatagtggatacttaagcagtttgaagcaagaactatccaagaagaaaaagaaaggtaaa cttcctaaagaagcacggcagaagcttctcacgtggtgggagttgcattacaagtggccatatccttctgagtcaga gaaggtagcgttggcggaatcaacggggttagatcagaaacaaatcaacaattggttcataaaccaaagaaagcg tcactggaaaccatctgaagacatgcagttcatggtgatggatggtctgcagcacccgcaccacgcagctctgtac atggatggtcattacatgggtgatggaccttatcgtctcggtccataagacatccaggtaccggatcccg 3' SEQ ID NO: 7predicted bp-2 protein (Protein Sequence).
MEEYQHDNSSTPQRVSFLYSPISSSNKNDNTSDT SSNYGPG
YNNTNNNNHHHQHMLFPHMSSLLPQTTENCFRSDHDQPNNNPSVI~SEA
SSSRINHYSMLMRAIHNTQEANN~NNNDNVSDVEAMKAI~IIAHPHYSTLL
QAYLDCQI~IGAPPDVVDRITAARQDFEARQ*
SEQ ID NO: 8DNA SEQ 951 (Synthetic DNA) 5'cccaagcttagatctttcggtctagtgcagtgatg 3' Sequence ID NO: 9. ~ DNA SEQ 952 (Synthetic DNA) 5' ccggatcccagatgagtaaagatttg 3' SEQ ID NO: 10 DNA SEQ 956 (Synthetic DNA) 5' gaagatctgtcgacgccttgtgcttgattgagactcca 3' SEQ ID.NO: 11:, B. napus by gene(BnBP) (cDNA Sequence) 5'ggcacgagcacattagttttttatattctctctctctctctctctttctctctcaacttttattcatctgggtatgg aagaat atcaacatgaaagcagatccactcctcatagagtaagtttcttgtactctccaatctcttcttccaacaaaaatgataa c accaccaccaacaacaataataccaattatggttctggttacaataatactaataacaataatcatcaacaacacatgt , .
tgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccgatcatgatcagcctaccaacgc atctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaagccatccacaatactcaaga aactaacaacaacaacaatgatacggaatccatgaaagctaagatcatcgctcatccccactactccaccctcctac acgcctacttggactgccagaagattggagcaccacctgaggtggtcgataaaattacggcggcaagacaagagt tcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctagagacccggaattggatcaattcatg gaagcatactgtgatatgctggttaaatatcgagaggagctaacacggcccattgaagaagcaatggagtatatac gtcgtattgaatctcaaattagcatgttgtgtcagggtcccattcacatcctcaacaatcctgatgggaaaagtgaag gaatagaatcatcagacgaagagcaagataataacaacagtggaggggaagcagaattaccggaaatagaccc gagggcggaagatcgggaactcaagaatcacttgctgaagaagtacagtggatacttgagcagtctaaagcaag aactgtccaagaaaaaaaagaaaggtaaacttcccaaagaagcaaggcagaagcttctcacgtggtgggaattgc attacaagtggccgtatccttctgaatcagagaaggtggcgttggcggaatcaacggggttagatcagaaacagat caacaattggttcataaaccaaagaaaacgtcactggaaaccgtccgaggacatgcagttcatggtgatggatggt ctacagcacccgcaccacgcagctctatacatggatggtcattacatgggcgatggtccttatcgtcttggaccata agagaccacatgcagatatccagaagggttagccatataataacaaccttttgttgcctctctcgtttacagttcatga t ttcaactttccttcacaagtttgctacctatagctttattttcttacccgtatttaatgtcttatatcgttcaaggggt ttgaga cttcctagtcattttcactttttattttgtatttttcataatgttttatttataa tatgtgttctaataatgtgtgaaaagagatgttt ttatgaattttaaaaaaaaaaaaaaaaaaaa 3' SEQ ID NO: 12: PCR Primer (Synthetic DNA) 5'-cgggatccatggaagaatatcaacatgaa-3' SEQ ID NO: 13: PCR Primer (Synthetic DNA) 5'-cgggatccggtaccttatggtccaagacgat-3' Seq ID NO: 14: B. raga by gene (cDNA Sequence) 5'cgggatccatggaagaatatcaacatgaaagcagatccactcctcatagagtaagtttcttgtactctccaatctct tcttccaacaaaaatgataacaccaccaccaacaacaataataccaattatggttctggttacaataatactaataaca ataatcatcaacaacacatgttgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccga t catgatcagccaaccaacgcatctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaa gccatccacaatactcaagaagctaacaacaacaacaacaacaaygatatggaatccatgaaagctaagatcatc gctcatcctcactactccaccctcctacacgcctacttggactgccagaagattggagcaccacctgaagtggttga taaaattacggcggcaagacaagaattcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtcta gagaccccgaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgagaggagctaacacggcc ~
cattgaagaagcaatggagtatatacgtcgtattgaatctcagattagcatgttgtgtcagggtcccattcacatcctc aacaatcctgatgggaaaagtgaaggaatggaatcatcagacgaagagcaagataataacaacagtggagggg aagcagaattaccggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaaatacagt ggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcccaaagaagcaaggca gaagcttctcacgtggtgggaattgcattacaagtggccgtatccttctgaatcagagaaggtggcgttggcggaat caacggggttagatcagaaacagatcaacaattggttcataaaccaaagaaaacgtcactggaaaccgtccgarg acatgcagttcatggtgatggatggtctacagcacccgcaccacgcagctctatacatggatggtcattacatgggc gatggcccttatcgtcttggaccataaggtaccggatcccg3' SEQ ID NO: 15: B. Oleracea by gene (cDNA Sequence) 5'cgggatccatggaagaatatcaacatgaaagcagatccactcctcatagagtaagtttcttgtactctccaatctct tcttccaacaaaaatgataacaccaccaccaacaacaataataccaattatggttctggttacaataatactaataaca ataatcatcaacaacacatgttgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccga t catgatcagcctaccaacgcatctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaa gccatccacaatactcaagaaactaacaacaacaacaatgatacggaatccatgaaagctaagatcatcgctcafc cccactactccaccctcctacacgcctacttggactgccagaagattggagcaccacctgaggtggtcgataaaatt acggcggcaagacaagagttcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctagagac ccggaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgagaggagctaacacggcccattga agaagcaatggagtatatacgtcgtattgaatctcaaattagcatgttgtgtcagggtcccattcacatcctcaacaat cctgatgggaaaagtgaaggaatagaatcatcagacgaagagcaagataataacaacagtggaggggaagcag aattaccggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaagtacagtggatact tgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcccaaagaagcaaggcagaagctt ctcacgtggtgggaattgcattacaagtggccgtatccttctgaatcagagaaggtggcgttggcggaatcaacgg ggttagatcaaaaacagatcaacaattggttcataaaccaaagaaaacgtcactggaaaccgtccgaggacatgc agttcatggngatggatggtctacagcacccgcaccacgcagctctatacatggatggtcattacatgggcgatgg tccttatcgtcttggaccataaggtaccggatcccg3' Seq ID NO: 16: PCR Primer (Synthetic DNA) S'-ataacaccaccaccaacaac-3' Seq ID NO: 17: PCR Primer (Synthetic DNA) 5'-actaggaagtctcaaacccc-3' Seq ID NO: 18: PCR Primer (Synthetic DNA) 5'-tcaacatgaaagcagatccac-3' Seq ID NO: 19: PCR Primer (Synthetic DNA) 5'-aacgagagaggcaacaaaag-3' Seq ID NO: 20: B. napus BP genomic fragment (Genomic DNA) 5'ataacaccaccaccaacaacaataataccaattatggttctggttacaataatactaataacaataatcatcaacaa cacatgttgttcccacatatgagctctcttcttcctcaaacgactgagaattgcttccgatccgatcatgatcagccaa c caacgcatctgttaaatcagaagcaagctcctcaagaatcaatcactactctatgttgatgaaagccatccacaatac tcaagaagctaacaacaacaacaacaacaatgatatggaatceatgaaagctaagatcatcgctcatccgcactac tccaccctcctacacgcctacttggactgccagaaggttatatagatttagcactggatttcgttttatttttgttgta gta atatataaaataccactcttgtttgtttaaattaacgagatgatatgcgtaaatatgttcacgggttgcatatacagat tg gagcaccacctgaagtggttgataaaattacggcggcaacacaagagttcgaggcgaggcagcagcggccaac agcatccgtaactgcgctgtctagagaccccgaattggatcaattcatggtaaattaattatcaaactgaattatagtg ggtcgtttcttcaagtgtatatgttaagtctttatttttgtttgtatcgtaaattttatcaacaggaagcatactgtga tatgct , ggttaaatatcgagaggagctaacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcagatta gcatgttgtgtcagggtcccattcacatcctcaacaatcctggtaaatgtcataaaactcacaaatacatatacatgea tatacccacatgtaaccattgaatgtagaaaagaaaatataatgccaaggtagggctcatgatgaatttcaagagca acattggcgcgtatttctttggttcccgggaaagttttgtaccaattagattatgataaggcgaccaaaaaataattat g attatatttggttaaaatttttcatctaaacattcaagtgttaattaagatcataaaa~ataatagttaatatgataga aattc gtaggctgcagacagatgtgcacatttgctcttgttttccctattgtagaatccatccaaagagggtggggcttttttt g gtttcttacttttaacccggcccaaagtactactgtcacaaacactttttgttgttcactatgaaaaaaaatacaaata gg tattctcaattccagtatgcaaaatgtttcaaattttcataaaaaagtcagtacgactaaattgctcgtgaattatgaa tca aaatataagactgatgaaaagctaaaatttgaaacagatgggaaaagtgaaggaatggaatcatcagacgaagag caagataataacaacagtggaggggaagcagaaattaccggaaatagacccggagggcggaagatcgggaac tcaagaatcacttgctgaagaagtacagtggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaa aggtaaacttcccaaagaagcaaggcagaagcttctcacgtggtgggaattgcattacaagtggccgtatccttctg tacgtataattttactctcatctctctatgctttcagtcttttaaaatatacactctatataaatactagaaccagtct tttgga aaacaatgtagatgctgggaatctccaatttgccctgattttctctaaagggccttccttaggccgattaggctctttg c agggatcatttgtagatgctaggctctttgcagagataatttgtgttcaaacctttatgcgtttccatatttcataaca tat gtatatatacatatatcaaacacgtttttatctatagttatctaaattttgaaataattttgaagtttaagtccgtgga tctatt gttatagtttatcagcttcaggaaataaaacaaataaaaccgaatgtggtgatggcgaaggtctttaatattgggtata catatttaccacaaaaaaaatgatatattatatagaatggctgtttgttgttaaaaaatcctggtattttttttggtaa atatg ataccatttccaatgaacaccaaaaatgataccatcccaccaaatttgttgtaatgtaaaaagtattacaccaaattaa c aatattcattacaccaaatattaaaataatatattttattattttttatttaataatagatagattagttttttactta gttataact tatagttaaaatgagtatatcataatatcttgtatttttaatccatatttttacattactaaaacattaaactattatt ttattttat aatttaattaatagtatataattaaatgagtattataaattatattaaatggtaacaaaataaaaatgatcttcatttt aaatg caaaaagttttaatttttacaaatattttaaataaaataaataataaagtatacacattmactaaaagaaaaatagctt at ataaaaataaaattaccaaatattaatatatatatatatatatatataaactaaatgtgatacatatatataattagtc aatta taaacaattaatgtattaaattactaaaactaaaaagttgataatataaaatattattttggtgtagaatttggtgtga tggt tggacatgaaaaataaagtttaacmcttaaacmccmmtyctggtgtaatttcarcactaattttagtgttatggttgg agataccctaacagaaccatgcttcgtgctttgaaaaaaaaatcagtcgtctaaagctacaataaaaaaattggagg gaaatattttgtttcaaattaggttatgtatttacacagatatttgtttggattcttgtctgagaagtgcatggcatta catttt gtgttacaaaagaagttgaatgatctgagtatcatatttattgaaagcgtgttggtatatgtgtgttgctaaaaagttc tat aagaaaattggataaatttgctttaaaatttccatagtatatcactattttgtatgttcggaaaccttgatatgtatac ttttc ccttataacgagggccttaatattctttagtcatctagattgttcgaagcagcagactgtaatttataacttcgtctga cta tcatctaccttttttatagaacataccttttcttttattgaaactaatatcgtctagcttttgtgattaaatctaccgt ttttaaac aatgaacaatactaaaaaagtgatgatatggatatggttctgatttgtgttgtgtggcaggagtcagagaaggtggcg ttggcggaatccaacggggttagatcagaaacagatcaacaattggttcataaaccaaagaaaacgtcactggaaa ccgtccgaagacatgcagttcatggtgatggatggtctacagcacccgcaccacgcagctctatacatggatggtc attacatgggcgatggtccttatcgtcttggaccataagagaccgcatgcagatatccagaagggttagccatataat aacaaccttttgttgcctctctcgtttacagttcatgatttcaactttccttcacaagtttgctacctatagctttatt ttcttac ccgtatttaatgtcttatatcgttcaaggggtttgagacttcctagt3' 5. SEQ ID NO: 2I : PCR Primer (Synthetic DNA) 5'-catgatcggatcggaagcaattctcagtcg-3' SEQ ID NO: 22: PCR Primer (Synthetic DNA) 5'-aaaagttgagagagaaagagagagagagag-3' IO
SEQ ID NO: 23: BnBP promoter (Bnbppr900) (Genomic DNA) 5'aaaaaatgcttacaaatatctgcacatcaaccaatctgttacataaatagatcttcttgtgggggtagggttaacaa atattttcctctttttcttttctcaaaaatgtatcggtactgatatagccgcggagacctggttcattaaaacattggc ggt acatcttaataatcaaaacattgacggcacatcttaatcctagagtttaaccacattatatatcatagagtaacaaact ta gtttttgacccaaaagaagaaaaaaaacttccaattttctagtacagaataagcctacgagagggaaacagaagag aaaggaggaaagaagggaagcctttgccttatctcttgtccattctctcttacctttatttttaattttcaaatattta ttatt gccaccaaagcaaacgacgtcttgtcaatccactcaacccacccaacttcttaattattgttaacacatctctcctctt t ctctctcatctttttataatttcttctcttccatgtcactttttgacgaattctatttacttagttcgttttttcttcc tcaaaatatc tcgttttcaatttatttgttttgttgggtgcaacttcacctcacaattttttttatgaagcacctttctgattcgtaga tatgagt cgtctagtcatgtggatttgatttggttaaagtctaacatcgacctttgattgaaataaggacaaaagaaagaatacat acatccccttcattttgcacccatccctttattttctagggttttatttttatcacattagttttttatattctctctc tctctctctc tttctctctcaactttt3' SEQ ID NO: 24: BnBP promoter (Bnbppr 1000)(Genomic DNA) 5'aaatctttatcttctctgtttcttgtgcaatcttctatccgaaaacgagtacaatataatctctctccaccgatgta atac gaatatcaaatcagaaattaatcatttgatcatattctcaaaacatctaaatttattttacaaattgcttacaaatatc tgca catcaaccaatctgttacataaatagatcttcttgtaggggtaaggttaacaaatatttttttctttttcttttctcca aaatgt atcggtactgatatagccgcggagacctggttcatcaaaacattgacggtacatcttaattcgagagtttaaccaaatt atatcatagagtaacaaacttagtttttgacccaaaataagagaaaaaactttcaattttctaatacggaataagctat g agagggagacagaagagaaagtaggaaagaagggaagcctttgccttatctcttgtccattctctcttacctttatttt aattttcaaatatttattattgccaccaaagcaaacgacgtcttgtcaatccactcaacccacccaacttcttaattat tgt taacacatctctcctctttctctctcatctttttataatttcttctcttccatgtcactttttgacgaattctatttac ttagttcgtt ttttcttcctcaaaatatctcgttttcaatttatttgttttgttgggtgcaacttcacctcacaattttttttatgaag cacctttc tgattcgtagatatgagtcgtctagtcatgtggatttgatttggttaaagtctaacatcgacctttgattgaaataaga ac aaaagaaagaatacatacatccccttcattttgcacccatccctttattttctagggttttatttttatcacattagtt ttttat attctctctctctctctctctctttctctctcaactttt3' 1./18 SEQUENCE LISTING
<110> NATIONAL RESEARCH COUNCIL OF CANADA
<120> METHODS FOR MODIFICATION OF PLANT INFLORESCENCE
ARCHITECTURE
<130> 47580-PT
<150> US 601281,901 <151> 2001-03-29 <160> 24 <170> Patentln version 3.1 <210> 1 <211> 29 <212> DNA
<213> Artificial sequence <220>
<223> 954 DNA SEQ - PCR primer <400> 1 cgggatccat ggaagaatac cagcatgac 29 <210> 2 <211> 34 <212> DNA
<213> Artificial sequence <22D>
<223> 955 DNA SEQ - PCR primer x/18 <400> 2 cgggatccgg tacctggatg tcttatggac cgag 34 <210> 3 <211> 19 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ gapC-UP - PCR primer <400> 3 accactaact gccttgctc 19 <210> 4 <211> 22 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ gapC-DN
<400> 4 caatttcaca aacttgtcgc tc 22 <210> 5 <211> 1227 <212> DNA
<213> Arabidopsis sp.
<400> 5 cgggatccat ggaagaata'c cagcatgaca acagcaccac tcctcaaaga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa acgataacac aagtgatacc aacaacaaca 120 acaacaataa taatagtagc aattatggtc ctggttacaa taatactaac aacaacaatc 180 atcaccacca acacatgttg tttccacata tgagctctct tctccctcaa acaaccgaga 240 attgcttccg atctgatcat gatcaaccca acaacaacaa caacccatct gttaaatctg 300 aagctagctcctcaagaatcaatcattactccatgttaatgagagccatccacaatactc360 aagaagctaacaacaacaacaatgacaacgtaagcgatgttgaagccatgaaggctaaaa420 tcattgctcatcctcactactctaccctcctacaagcttacttggactgccaaaagattg480 gagctccacctgatgtggttgatagaattacggcggcacggcaagactttgaggctcgac540 aacagcggtcaacaccgtctgtctctgcctcctctagagacccggagttagatcaattca600 tggaagcatactgtgacatgttggttaaatatcgtgaggagctaacaaggcccattcagg660 aagcaatggagtttatacgtcgtattgaatctcagcttagcatgttgtgtcagagtccca720 ttcacatcctcaacaatcctgatgggaagagtgacaatatgggatcatcagacgaagaac780 aagagaataacagcggaggggaaacagaattaccggaaatagacccgagggccgaagatc840 gggaactcaagaaccatttgctgaagaagtatagtggatacttaagcagtttgaagcaag900 aactatccaagaagaaaaagaaaggtaaacttcctaaagaagcacggcagaagcttctca960 cgtggtgggagttgcattacaagtggccatatccttctgagtcagagaaggtagcgttgg1020 cggaatcaacggggttagatcagaaacaaatcaacaattggttcataaaccaaagaaagc1080 gtcactggaaaccatctgaagacatgcagttcatggtgatggatggtctgcagcacccgc1140 accacgcagctctgtacatggatggtcattacatgggtgatggaccttatcgtctcggtc1200 cataagacat ccaggtaccg gatcccg 1227 <210> 6 <211> 1221 <212> DNA
<213> Arabidopsis sp.
<400> 6 cgggatccat ggaagaatac cagcatgaca acagctccac tcctcaaaga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa acgataacac aagtgatacc aacaacaaca 120 acaacaataa taatagtagc aattatggtc ctggttacaa taatactaac aacaacaatc 180 atcaccacca acacatgttg tttccacata tgagctctct tctccctcaa acaaccgaga 240 attgcttccg atccgatcat gatcaaccca acaacaaccc atctgttaaa tctgaagcta 300 , gctcctcaag aatcaatcat tactccatgt taatgagagc catccacaat actcaagaag 360 ctaacaacaa caacaatgat aacgtaagcg atgttgaagc catgaaggct aaaatcattg 420 ctcatcctca ctactctacc ctcctacaag cttacttgga ctgccaaaag attggagctc 480 cacctgacgt ggttgataga attacggcgg cacggcaaga ctttgaggct cgacaatagc 540 ggtcaacacc gtctgtctct gcctcctcta gagacccgga gttagatcaa ttcatggaag 600 catactgtga catgttggtt aaatatcgtg aggagctaac aaggcccatt caggaagcaa 660 tggagtttat acgtcgtatt gaatctcagc ttagcatgtt gtgtcagagt cccattcaca 720 tcctcaacaa tcctgatggg aagagtgaca atatgggatc atcagacgaa gaacaagaga 780 ataacagcgg aggggaaaca gaattaccgg aaatagaccc gagggccgaa gatcgggaac 840 tcaagaacca tttgctgaag aagtatagtg gatacttaag cagtttgaag caagaactat 900 ccaagaagaa aaagaaaggt aaacttccta aagaagcacg gcagaagctt ctcacgtggt 960 gggagttgca ttacaagtgg ccatatcctt ctgagtcaga gaaggtagcg ttggcggaat 1020 caacggggtt agatcagaaa caaatcaaca attggttcat aaaccaaaga aagcgtcact 1080 ggaaaccatc tgaagacatg cagttcatgg tgatggatgg tctgcagcac ccgcaccacg 1140 5/1~
cagctctgta catggatggt cattacatgg gtgatggacc ttatcgtetc ggtccataag 1200 acatccaggt accggatccc g 1221 <210> 7 <211> 176 <212> PRT
<213> Arabidopsis sp.
<400> 7 Met Glu Glu Tyr Gln His Asp Asn Ser Ser Thr Pro Gln Arg Val Ser Phe Leu Tyr Ser Pro Ile Ser Ser Ser Asn Lys Asn Asp Asn Thr Ser Asp Thr Asn Asn Asn Asn Asn Asn Asn Asn Ser Ser Asn Tyr Gly Pro Gly Tyr Asn Asn Thr Asn Asn Asn Asn His His His Gln His Met Leu Phe Pro His Met Ser Ser Leu Leu Pro Gln Thr Thr Glu Asn Cys Phe Arg Ser Asp His Asp Gln Pro Asn Asn Asn Pro Ser Val Lys Ser Glu Ala Ser Ser Ser Arg Ile Asn His Tyr Ser Met Leu Met Arg Ala Ile His Asn Thr Gln Glu Ala Asn Asn Asn Asn Asn Asp Asn Val Ser Asp Val Glu Ala Met Lys Ala Lys Ile Ile Ala His Pro His Tyr Ser Thr Leu Leu Gln Ala Tyr Leu Asp Cys Gln Lys Ile Gly Ala Pro Pro Asp Val Val Asp Arg Ile Thr Ala Ala Arg Gln Asp Phe Glu Ala Arg Gln <210> 8 <211> 35 <2l2> DNA
<2l3> Artificial sequence <220>
<223> DNA SEQ 951 - PCR primer <400> 8 cccaagctta gatctttcgg tctagtgcag tgatg 35 <210> 9 <211> 26 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ 952 - PCR primer <400> 9 ccggatccca gatgagtaaa gatttg 26 <210> 10 <211> 38 <212> DNA
<213> Artificial sequence <220>
<223> DNA SEQ 956 - PCR primer <400> 10 gaagatctgt cgacgccttg tgcttgattg agactcca 3g <210> 11 <211> 1515 <212> DNA
<213> Brassica napus <400> 11 ggcacgagca cattagtttt ttatattctc tctctctctc tctctttctc tctcaacttt 60 tattcatctg ggtatggaag aatatcaaca tgaaagcaga tccactcctc atagagtaag 120 tttcttgtac tctccaatct cttcttccaa caaaaatgat aacaccacca ccaacaacaa 180 taataccaat tatggttctg gttacaataa tactaataac aataatcatc aacaacacat 240 gttgttccca catatgagct ctcttcttcc tcaaacgact gagaattgct tccgatccga 300 tcatgatcag cctaccaacg catctgttaa atcagaagca agctcctcaa gaatcaatca 360 ctactctatg ttgatgaaag ccatccacaa tactcaagaa actaacaaca acaacaatga 420 tacggaatccatgaaagctaagatcatcgctcatcc~cactactccaccctcctacacgc480 ctacttggactgccagaagattggagcaccacctgaggtggtcgataaaattacggcggc540 aagacaagagttcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctag600 agacccggaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgaga660 ggagctaacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcaaat720 tagcatgttgtgtcagggtcccattcacatcctcaacaatcctgatgggaaaagtgaagg780 aatagaatcatcagacgaagagcaagataataacaacagtggaggggaagcagaattacc840 ggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaagtacag900 tggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcc960 caaagaagcaaggcagaagcttctcacgtggtgggaattgcattacaagtggccgtatcc1020 ttctgaatcagagaaggtggcgttggcggaatcaacggggttagatcagaaacagatcaa1080 caattggttc ataaaccaaa gaaaacgtca ctggaaaccg tccgaggaca tgcagttcat 1140 ggtgatggat ggtctacagc acccgcacca cgcagctcta tacatggatg gtcattacat 1200 gggcgatggt ccttatcgtc ttggaccata agagaccaca tgcagatatc cagaagggtt 1260 agccatataa taacaacctt ttgttgcctc tctcgtttac agttcatgat ttcaactttc 1320 cttcacaagt ttgctaccta tagctttatt ttcttacccg tatttaatgt cttatatcgt 1380 tcaaggggtt tgagacttcc tagtcatttt cactttttat tttgtatttt tcataatgtt 1440 ttatttataa tatgtgttct aataatgtgt gaaaagagat gtttttatga attttaaaaa 1500 aaaaaaaaaa aaaaa 1515 <210> 12 <211> 29 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 12 cgggatccat ggaagaatat caacatgaa 29 <210> 13 <211> 31 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 13 cgggatccgg taccttatgg tccaagacga t 31 <210> 14 <211> 1186 <212> DNA
<213> Brassica raga <400> 14 cgggatccat ggaagaatat caacatgaaa gcagatccac tcctcataga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa atgataacac caccaccaac aacaataata 120 ccaattatgg ttctggttac aataatacta ataacaataa tcatcaacaa cacatgttgt 180 tcccacatat gagctctctt cttcctcaaa cgactgagaa ttgcttccga tccgatcatg 240 atcagccaac caacgcatct gttaaatcag aagcaagctc ctcaagaatc aatcactact 300 ctatgttgat gaaagccatc cacaatactc aagaagctaa caacaacaac aacaacaayg 360 atatggaatccatgaaagctaagatcatcgctcatcctcactactccaccctcctacacg420 cctacttggactgccagaagattggagcaccacctgaagtggttgataaaattacggcgg480 caagacaagaattcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtcta540 gagaccccgaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgag600 aggagctaacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcaga660 ttagcatgttgtgtcagggtcccattcacatcctcaacaatcctgatgggaaaagtgaag720 gaatggaatcatcagacgaagagcaagataataacaacagtggaggggaagcagaattac780 cggaaatagacccgagggcggaagatcgggaactcaagaatcacttgctgaagaaataca840 gtggatacttgagcagtctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttc900 ccaaagaagcaaggcagaagcttctcacgtggtgggaattgcattacaagtggccgtatc960 cttctgaatcagagaaggtggcgttggcggaatcaacggggttagatcagaaacagatca1020 acaattggtt cataaaccaa agaaaacgtc actggaaacc gtccgargac atgcagttca 1080 tggtgatgga tggtctacag cacccgcacc acgcagctct atacatggat ggtcattaca 1140 tgggcgatgg cccttatcgt cttggaccat aaggtaccgg atcccg 118&
<210> 15 <211> 1180 <212> DNA
<213> Brassica oleracea <220>
<221> misc feature <222> (1078)..(1078) <223> n = a, c, g, or t <400> 15 cgggatccat ggaagaatat caacatgaaa gcagatccac tcctcataga gtaagtttct 60 tgtactctcc aatctcttct tccaacaaaa atgataacac caccaccaac aacaataata 120 ccaattatgg ttctggttac aataatacta ataacaataa tcatcaacaa cacatgttgt 180 tcccacatat gagctctctt cttcctcaaa cgactgagaa ttgcttccga tccgatcatg 240 atcagcctac caacgcatct gttaaatcag aagcaagctc ctcaagaatc aatcactact 300 ctatgttgatgaaagccatccacaatactcaagaaactaacaacaacaacaatgatacgg360 aatccatgaaagctaagatcatcgctcatccccactactccaccctcctacacgcctact420 tggactgccagaagattggagcaccacctgaggtggtcgataaaattacggcggcaagac480 aagagttcgaggcgaggcagcagcggccaacagcgtccgtaactgcgctgtctagagacc540 cggaattggatcaattcatggaagcatactgtgatatgctggttaaatatcgagaggagc600 taacacggcccattgaagaagcaatggagtatatacgtcgtattgaatctcaaattagca660 tgttgtgtca gggtcccattcacatcctcaacaatcctgatgggaaaagtgaaggaatag720 aatcatcaga cgaagagcaagataataacaacagtggaggggaagcagaattaccggaaa780 tagacccgag ggcggaagatcgggaactcaagaatcacttgctgaagaagtacagtggat840 acttgagcag tctaaagcaagaactgtccaagaaaaaaaagaaaggtaaacttcccaaag900 aagcaaggca gaagcttctcacgtggtgggaattgcattacaagtggccgtatccttctg960 aatcagagaa ggtggcgttggcggaatcaacggggttagatcaaaaacagatcaacaatt1020 ggttcataaa ccaaagaaaacgtcactggaaaccgtccgaggacatgcagttcatggnga1080 tggatggtct acagcacccgcaccacgcagctctatacatggatggtcattacatgggcg1140 atggtcctta tcgtcttggaccataaggtaccggatcccg 1180 <210> 16 <211> 20 <212> DNA
<213> Artificial uence seq <220>
<223> PCR primer <400> 16 ataacaccac caccaacaac 20 <210> 17 <211> 20 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 17 actaggaagt ctcaaacccc 20 <210> 18 <211> 21 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 18 tcaacatgaa agcagatcca c 21 <210> 19 <211> 20 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 19 aacgagagag gcaacaaaag '20 <210> 20 <211> 3750 <212> DNA
<213> Brassica napus <400> 20 ataacaccac caccaacaac aataatacca attatggttc tggttacaat aatactaata 60 acaataatca tcaacaacac atgttgttcc cacatatgag ctctcttctt cctcaaacga 120 ctgagaattg cttccgatcc gatcatgatc agccaaccaa cgcatctgtt aaatcagaag 180 caagctcctc aagaatcaat cactactcta tgttgatgaa agccatccac aatactcaag 240 aagctaacaa caacaacaac aacaatgata tggaatccat gaaagctaag atcatcgctc 300 atccgcacta ctccaccctc ctacacgcct acttggactg ccagaaggtt atatagattt 360 agcactggat ttcgttttat ttttgttgta gtaatatata aaataccact cttgtttgtt 420 taaattaacg agatgatatg cgtaaatatg ttcacgggtt gcatatacag attggagcac 480 cacctgaagt ggttgataaa attacggcgg caacacaaga gttcgaggcg aggcagcagc 540 ggccaacagc atccgtaact gcgctgtcta gagaccccga attggatcaa ttcatggtaa 600 attaattatc aaactgaatt atagtgggtc gtttcttcaa gtgtatatgt taagtcttta 660 tttttgtttg tatcgtaaat tttatcaaca ggaagcatac tgtgatatgc tggttaaata 720 tcgagaggag ctaacacggc ccattgaaga agcaatggag tatatacgtc gtattgaatc 780 tcagattagc atgttgtgtc agggtcccat tcacatcctc aacaatcctg gtaaatgtca 840 taaaactcac aaatacatat acatgcatat acccacatgt aaccattgaa tgtagaaaag 900 aaaatataat gccaaggtag ggctcatgat gaatttcaag agcaacattg gcgcgtattt 960 ctttggttcc cgggaaagtt ttgtaccaat tagattatga taaggcgacc aaaaaataat 1020 tatgattata tttggttaaa atttttcatc taaacattca agtgttaatt aagatcataa 1080 aatataatag ttaatatgat agaaattcgt aggctgcaga cagatgtgca catttgctct 1140 tgttttccct attgtagaat ccatccaaag agggtggggc tttttttggt ttcttacttt 1200 taacccggcc caaagtacta ctgtcacaaa cactttttgt tgttcactat gaaaaaaaat 1260 acaaataggt attctcaatt ccagtatgca aaatgtttca aattttcata aaaaagtcag 1320 tacgactaaa ttgctcgtga attatgaatc aaaatataag actgatgaaa agctaaaatt 1380 tgaaacagat gggaaaagtg aaggaatgga atcatcagac gaagagcaag ataataacaa 1440 cagtggaggg gaagcagaaa ttaccggaaa tagacccgga gggcggaaga tcgggaactc 1500 aagaatcact tgctgaagaa gtacagtgga tacttgagca gtctaaagca agaactgtcc 1560 aagaaaaaaa agaaaggtaa acttcccaaa gaagcaaggc agaagcttct cacgtggtgg 1620 gaattgcatt acaagtggcc gtatccttct gtacgtataa ttttactctc atctctctat 1680 gctttcagtc ttttaaaata tacactctat ataaatacta gaaccagtct tttggaaaac 1740 aatgtagatg ctgggaatct ccaatttgcc ctgattttct ctaaagggcc ttccttaggc 1800 cgattaggct ctttgcaggg atcatttgta gatgctaggc tctttgcaga gataatttgt 1860 gttcaaacct ttatgcgttt ccatatttca taacatatgt atatatacat atatcaaaca 1920 cgtttttatc tatagttatc taaattttga aataattttg aagtttaagt ccgtggatct 1980 attgttatag tttatcagct tcaggaaata aaacaaataa aaccgaatgt ggtgatggcg 2040 aaggtcttta atattgggta tacatattta ccacaaaaaa aatgatatat tatatagaat 2100 ggctgtttgt tgttaaaaaa tcctggtatt ttttttggta aatatgatac catttccaat 2160 gaacaccaaa aatgatacca tcccaccaaa tttgttgtaa tgtaaaaagt attacaccaa 2220 attaacaata ttcattacac caaatattaa aataatatat tttattattt tttatttaat 2280 aatagataga ttagtttttt acttagttat aacttatagt taaaatgagt atatcataat 2340 atcttgtatt tttaatccat atttttacat tactaaaaca ttaaactatt attttatttt 2400 ataatttaat taatagtata taattaaatg agtattataa attatattaa atggtaacaa 2460 aataaaaatg atcttcattt taaatgcaaa aagttttaat ttttacaaat attttaaata 2520 aaataaataa taaagtatac acattmacta aaagaaaaat agcttatata aaaataaaat 2580 taccaaatat taatatatat atatatatat atataaacta aatgtgatac atatatataa 2640 ttagtcaatt ataaacaatt aatgtattaa attactaaaa ctaaaaagtt gataatataa 2700 aatattattt tggtgtagaa tttggtgtga tggttggaca tgaaaaataa agtttaacmc 2760 ttaaacmccm mtyctggtgt aatttcarca ctaattttag tgttatggtt ggagataccc 2820 taacagaacc atgcttcgtg ctttgaaaaa aaaatcagtc gtctaaagct acaataaaaa 2880 aattggaggg aaatattttg tttcaaatta ggttatgtat ttacacagat atttgtttgg 2940 attcttgtct gagaagtgca tggcattaca ttttgtgtta caaaagaagt tgaatgatct 3000 gagtatcata tttattgaaa gcgtgttggt atatgtgtgt tgctaaaaag ttctataaga 3060 aaattggata aatttgcttt aaaatttcca tagtatatca ctattttgta tgttcggaaa 3120 ccttgatatg tatacttttc ccttataacg agggccttaa tattctttag tcatctagat 3180 tgttcgaagc agcagactgt aatttataac ttcgtctgac tatcatctac cttttttata 3240 gaacatacct tttcttttat tgaaactaat atcgtctagc ttttgtgatt aaatctaccg 3300 tttttaaaca atgaacaata ctaaaaaagt gatgatatgg atatggttct gatttgtgtt 3360 gtgtggcagg agtcagagaa ggtggcgttg gcggaatcca acggggttag atcagaaaca 3420 gatcaacaat tggttcataa accaaagaaa acgtcactgg aaaccgtccg aagacatgca 3480 gttcatggtg atggatggtc tacagcaccc gcaccacgca gctctataca tggatggtca 3540 ttacatgggc gatggtcctt atcgtcttgg accataagag accgcatgca gatatccaga 3600 agggttagcc atataataac aaccttttgt tgcctctctc gtttacagtt catgatttca 3660 actttccttc acaagtttgc tacctatagc tttattttct tacccgtatt taatgtctta 3720 tatcgttcaa ggggtttgag acttcctagt 3750 <210> 21 <211> 30 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 21 catgatcgga tcggaagcaa ttctcagtcg 30 <210> 22 <211> 30 <212> DNA
<213> Artificial sequence <220>
<223> PCR primer <400> 22 aaaagttgag agagaaagag agagagagag 30 <210> 23 <211> 840 <212> DNA
<213> Brassica napus <400> 23 aaaaaatgcttacaaatatctgcacatcaaccaatctgttacataaatagatcttcttgt 60 gggggtagggttaacaaatattttcctctttttcttttctcaaaaatgtatcggtactga 120 tatagccgcggagacctggttcattaaaacattggcggtacatcttaataatcaaaacat 180 tgacggcacatcttaatcctagagtttaaccacattatatatcatagagtaacaaactta 240 gtttttgacccaaaagaagaaaaaaaacttccaattttctagtacagaataagcctacga 300 gagggaaacagaagagaaaggaggaaagaagggaagcctttgccttatctcttgtccatt 360 ctctcttacctttatttttaattttcaaatatttattattgccaccaaagcaaacgacgt 420 cttgtcaatccactcaacccacccaacttcttaattattgttaacacatctctcctcttt 480 ctctctcatctttttataatttcttctcttccatgtcactttttgacgaattctatttac 540 ttagttcgttttttcttcctcaaaatatctcgttttcaatttatttgttttgttgggtgc 600 aacttcacctcacaattttttttatgaagcac.ctttctgattcgtagatatgagtcgtct 660 agtcatgtggatttgatttggttaaagtctaacatcgacctttgattgaaataaggacaa 720 aagaaagaatacatacatccccttcattttgcaCCCatccctttattttctagggtttta 780 tttttatcacattagttttttatattctctctctctctctctctttctctctcaactttt 840 <210> 24 <211> 950 <212> DNA
<213> Brassica napus <400> 24 aaatctttatcttctctgtttcttgtgcaatcttctatccgaaaacgagtacaatataat60 ctctctccaccgatgtaatacgaatatcaaatcagaaattaatcatttgatcatattctc120 aaaacatctaaatttattttacaaattgcttacaaatatctgcacatcaaccaatctgtt180 acataaatagatcttcttgtaggggtaaggttaacaaatatttttttctttttcttttct240 ccaaaatgtatcggtactgatatagccgcggagacctggttcatcaaaacattgacggta300 catcttaattcgagagtttaaccaaattatatcatagagtaacaaacttagtttttgacc360 caaaataagagaaaaaactttcaattttctaatacggaataagctatgagagggagacag420 aagagaaagtaggaaagaagggaagcctttgccttatctcttgtccattctctcttacct480 ttattttaattttcaaatatttattattgccaccaaagcaaacgacgtcttgtcaatcca540 ctcaacccacccaacttcttaattattgttaacacatctctcctctttctctctcatctt600 tttataatttcttctcttccatgtcactttttgacgaattctatttacttagttcgtttt660 ttcttcctcaaaatatctcgttttcaatttatttgttttgttgggtgcaacttcacctca720 caattttttttatgaagcacctttctgattcgtagatatgagtcgtctagtcatgtggat780 ttgatttggttaaagtctaacatcgacctttgattgaaataagaacaaaagaaagaatac840 atacatccccttcattttgcacccatccctttattttctagggttttatttttatcacat900 tagttttttatattctctctctctctctctctctttctctctcaactttt 950
Claims (50)
1. A method of producing a transgenic plant with a modified inflorescence architecture characterised in that the method comprises the steps of:
(a) introducing into a plant cell capable of being transformed and regenerated into a whole plant a construct comprising, in addition to the DNA
sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNAT1 gene and encoding at least part of a KNAT1 gene product operably linked to a promoter; and (b) recovery of a plant which contains said nucleotide sequence and has a modified inflorescence architecture compared to an unmodified plant.
(a) introducing into a plant cell capable of being transformed and regenerated into a whole plant a construct comprising, in addition to the DNA
sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNAT1 gene and encoding at least part of a KNAT1 gene product operably linked to a promoter; and (b) recovery of a plant which contains said nucleotide sequence and has a modified inflorescence architecture compared to an unmodified plant.
2. A method according to claim 1, characterised in that said nucleotide sequence encodes a peptide having at least 50% homology to the peptide encoded by SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof.
3. A method according to claim 1, characterised in that said nucleotide sequence encodes a peptide having at least 70% homology to the peptide encoded by SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof.
4. A method according to claim 1, characterised in that said nucleotide sequence encodes a peptide having at least 90% homology to the peptide encoded by SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof.
5. A method according to claim 1, characterised in that said nucleotide sequence encodes a peptide having at least 95% homology to the peptide encoded by SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof.
6. A method according to claim 1, characterised in that said nucleotide sequence encodes a peptide having at least 99% homology to the peptide encoded by SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof.
7. A method according to claim 1, characterised in that said nucleotide sequence is SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof, or a nucleotide sequence that binds under stringent conditions to SEQ ID NO: 5 or 6, or a part thereof, or a complement thereof
8. A method according to claim 1, characterised in that said modified inflorescence architecture comprises an altered pedicel, peduncle or style.
9. A method according to claim 8, characterised in that said pedicel has an altered length compared to an unmodified plant.
10. A method according to claim 1, characterised in that said modified inflorescence architecture comprises downwardly pointing flowers.
11. A method according to claim 1, characterised in that said nucleotide sequence is derived from a plant of the genus Arabidopsis.
12. A method according to claim 1, characterised in that said nucleotide sequence is derived from a plant of the genus Brassica.
13. A method according to claim 1, characterised in that said plant is of the genus Arabidopsis.
14. A method according to claim 1, characterised in that said plant is of the genus Brassica.
15. A method according to claim 1, characterised in that said plant is selected from the group consisting of: a dicot, a monocot, and a member of Cruciferae.
16. A method according to claim 1, characterised in that expression of said nucleotide sequence in said plant generates a plant having a compact inflorescence compared to an unmodified plant.
17. A method according to claim 1, characterised in that expression of said nucleotide sequence in said plant generates a plant having an open inflorescence compared to an unmodified plant.
18. A method according to claim 1, characterised in that said nucleotide sequence is expressed in a sense direction for complementary inhibition of an endogenous KNAT1 gene in said plant, said plant having a compact inflorescence architecture compared to an unmodified plant.
19. A method according to claim 18, characterised in that said nucleotide sequence is a mutated KNAT1 gene.
20. A method according to claim 1, characterised in that said nucleotide sequence is expressed in an antisense direction for antisense inhibition of an endogenous KNAT1 gene of said plant, said plant having a compact inflorescence architecture and/or decreased pedicel length compared to an unmodified plant.
21. A method according to claim 1, characterised in that said nucleotide sequence is overexpressed in a sense direction, said plant having an open inflorescence architecture and/or increased pedicel length compared to an unmodified plant.
22. A method according to claim 1, characterised in that said plant harbours a bp mutation and expression of said nucleotide sequence is complementary to said mutation, said plant exhibiting a wild-type phenotype.
23. A method according to claim 1, characterised in that said promoter comprises a transcriptional regulatory region normally in operable association with an endogenous KNAT1 gene or homologue thereof.
24. A method according to claim 1, characterised in that said promoter comprises a transcriptional regulatory region that is not normally in operable association with an endogenous KNAT1 gene or homologue thereof.
25. A method according to claim 1, characterised in that said promoter is selected from the group consisting of a constitutive promoter, an inducible promoter, an organ specific promoter, a strong promoter, a weak promoter, and an endogenous KNAT1 promoter from Arabidopsis.
26. A method according to claim 1, characterised in that said nucleotide sequence is derived from a nucleotide sequence selected from the group consisting of SEQ ID NO:11, SEQ ID NO:14, SEQ ID NO:15, and SEQ ID
NO:20.
NO:20.
27. A method according to claim 1, characterised in that said promoter is derived from a functional portion of SEQ ID NO:23 or SEQ ID NO:24.
28. A method of identifying a plant that has been successfully transformed with a construct, characterised in that the method comprises the steps of:
(a) introducing into plant cells capable of being transformed and regenerated into whole plants a construct comprising, in addition to the DNA
sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNAT1 gene and encoding at least part of a KNAT1 gene product, operably linked to a promoter;
(b) regenerating said plant cells into whole plants; and (c) inspecting the inflorescences of said plants to determine those plants successfully transformed with said construct, and expressing said nucleotide sequence.
(a) introducing into plant cells capable of being transformed and regenerated into whole plants a construct comprising, in addition to the DNA
sequences required for transformation and selection in plants, a nucleotide sequence derived from a KNAT1 gene and encoding at least part of a KNAT1 gene product, operably linked to a promoter;
(b) regenerating said plant cells into whole plants; and (c) inspecting the inflorescences of said plants to determine those plants successfully transformed with said construct, and expressing said nucleotide sequence.
29. A method according to claim 28, characterised in that said plant cells and said regenerated whole plants harbour a bp mutation, and successful transformation and expression of said nucleotide sequence complements said mutation, thereby generating a plant exhibiting a wild-type phenotype.
30. A method according to 29, characterised in that said construct is bicistronic and further comprises a second DNA expression cassette for generating a transcript unrelated to said nucleotide sequence derived from a KNAT1 gene.
31. A transgenic plant generated by the method according to any one of claims 1 to 30.
32. The transgenic plant according to claim 31 characterised in that said transgenic plant is of the genus Arabidopsis.
33. The transgenic plant according to claim 31, characterised in that said transgenic plant is of the genus Brassica.
34. The transgenic plant according to claim 31, characterised in that said nucleotide sequence is derived from an Arabidopsis KNAT1 gene.
35. The transgenic plant according to claim 31, characterised in that said nucleotide sequence is derived from a Brassica KNAT1 gene.
36. The transgenic plant according to claim 31, characterised in that said plant is selected from the group consisting of a dicot, a monocot, and a member of Cruciferae.
37. The transgenic plant according to claim 31, characterised in that said modified inflorescence is compact compared to an unmodified plant.
38. The transgenic plant according to claim 31, characterised in that said modified inflorescence is open compared to an unmodified plant.
39. The transgenic plant according to claim 31, characterised in that said modified inflorescence architecture comprises an altered pedicel, peduncle or style.
40. The transgenic plant according to claim 39, characterised in that said altered pedicel has an altered length compared to an unmodified plant.
41. The transgenic plant according to claim 31, characterised in that said modified inflorescence architecture comprises downwardly pointing flowers.
42. An isolated nucleotide sequence for generating a transgenic plant with modified inflorescence architecture, characterised in that said isolated nucleotide sequence is derived from a KNAT1 gene and encodes at least part of a KNAT1 gene product.
43. The isolated nucleotide sequence according to claim 42, characterised in that said nucleotide sequence comprises a sequence selected from:
(a) SEQ ID NO:5 or 6, or a part thereof, or a complement thereof;
and (b) a nucleotide sequence encoding a peptide having at least 50%
homology to the peptide encoded by the nucleotide sequence defined in (a).
(a) SEQ ID NO:5 or 6, or a part thereof, or a complement thereof;
and (b) a nucleotide sequence encoding a peptide having at least 50%
homology to the peptide encoded by the nucleotide sequence defined in (a).
44. The isolated nucleotide sequence according to claim 42, characterised in that said nucleotide sequence encodes a peptide having at least 70% homology to the peptide encoded by SEQ ID NO:5 or 6, or a part thereof, or a complement thereof.
45. The isolated nucleotide sequence according to claim 42, characterised in that said nucleotide sequence encodes a peptide having at least 90% homology to the peptide encoded by SEQ ID NO:5 or 6, or a part thereof, or a complement thereof.
46. The isolated nucleotide sequence according to claim 42, characterised in that said nucleotide sequence encodes a peptide having at least 95% homology to the peptide encoded by SEQ ID NO:5 or 6, or a part thereof, or a complement thereof.
47. The isolated nucleotide sequence according to claim 42, characterised in that said nucleotide sequence encodes a peptide having at least 99% homology to the peptide encoded by SEQ ID NO:5 or 6, or a part thereof, or a complement thereof.
48. The isolated nucleotide sequence according to claim 42, characterised in that said nucleotide sequence hybridises under stringent conditions to the nucleotide sequence of SEQ ID NO:5 or 6, or a part thereof or a complement thereof.
49. An isolated nucleotide sequence for generating a transgenic plant with a modified inflorescence architecture compared to an unmodified plant, characterised in that said nucleotide sequence is derived from a construct selected from the group consisting of pRD400-951/955, pRD400-951/956, pRD400-35S::AtBPS, pRD400-35S::AtBPA/S, pRD400-35S::Atbp-2, pRD400-951/952::Atbp-2, pRD400-951/952::BnBPS, pRD400-35S::BnBPS, and pRD400-35S::BnBPA/S.
50. Use of an isolated nucleotide sequence according to any one of claims 42 to 49, for generating a transgenic plant with a modified inflorescence architecture.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US28190101P | 2001-03-29 | 2001-03-29 | |
US60/281,901 | 2001-03-29 | ||
PCT/CA2002/000434 WO2002079463A2 (en) | 2001-03-29 | 2002-03-28 | Methods for modification of plant inflorescence architecture |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2442755A1 true CA2442755A1 (en) | 2002-10-10 |
Family
ID=30444688
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002442755A Abandoned CA2442755A1 (en) | 2001-03-29 | 2002-03-28 | Methods for modification of plant inflorescence architecture |
Country Status (1)
Country | Link |
---|---|
CA (1) | CA2442755A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN109161553A (en) * | 2018-09-29 | 2019-01-08 | 安徽农业大学 | A kind of pears transcription factor PbBP and its application |
-
2002
- 2002-03-28 CA CA002442755A patent/CA2442755A1/en not_active Abandoned
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN109161553A (en) * | 2018-09-29 | 2019-01-08 | 安徽农业大学 | A kind of pears transcription factor PbBP and its application |
CN109161553B (en) * | 2018-09-29 | 2022-02-18 | 安徽农业大学 | Pear transcription factor PbBP and application thereof |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20090044293A1 (en) | Plants with altered root architecture, involving the rt1 gene, related constructs and methods | |
EP2527449A2 (en) | Methods involving genes encoding nucleoside diphosphatase kinase (NDK) polypeptides and homologs thereof for modifying the plant's root architecture | |
NZ294884A (en) | Regulation of flowering using the constans gene (co) derived from arabidopsis thaliana and brassica napus | |
US20110138501A1 (en) | Plants with altered root architecture, related constructs and methods involving genes encoding protein phophatase 2c (pp2c) polypeptides and homologs thereof | |
US20150299723A1 (en) | Plants with altered root architecture, related constructs and methods involving genes encoding leucine rich repeat kinase (llrk) polypeptides and homologs thereof | |
CA2877496A1 (en) | Terminating flower (tmf) gene and methods of use | |
US7960613B2 (en) | Plants with altered root architecture, involving the rum1 gene, related constructs and methods | |
AU758659B2 (en) | Pre-harvest sprouting | |
US20140007298A1 (en) | Plants with altered root architecture, related constructs and methods involving genes encoding protein phophatase 2c (pp2c) polypeptides and homologs thereof | |
US7393997B2 (en) | Methods for modification of plant inflorescence architecture | |
CA2442755A1 (en) | Methods for modification of plant inflorescence architecture | |
US20110191910A1 (en) | Plants with altered root architecture, related constructs and methods involving genes encoding lectin protein kinase (lpk) polypeptides and homologs thereof | |
AU768139B2 (en) | Plant lesion formation suppressing gene, Sp17 and use thereof | |
EP2326663A2 (en) | Plants with altered root architecture, related constructs and methods involving genes encoding rep2 polypeptides and homologs thereof | |
WO2008100552A2 (en) | Plants with altered root architecture, involving the rum1 gene, related constructs and methods |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Discontinued |