DE2031500A1

DE2031500A1 - Method and apparatus for developing an electrostatic latent image

Info

Publication number: DE2031500A1
Application number: DE19702031500
Authority: DE
Inventors: Richard Edward Webster; Oagley. Jack Richard Rochester: N Y Smith (V.St.A.)
Original assignee: Xerox Corp
Current assignee: Xerox Corp
Priority date: 1969-07-01
Filing date: 1970-06-25
Publication date: 1971-01-21
Also published as: ZA704474B; AT311791B; NL7009758A; GB1320509A; JPS5028177B1; FR2056398A5; CH513437A; PL72772B1; BE752802A; SE357269B; ES381297A1

Description

Patentanwälte Dipl.-Ing. F. Weickmann,Patent attorneys Dipl.-Ing. F. Weickmann,

Dipl.-Ing. H.Weickmann, Dipl.-Phys. Dr. K.Fincke Dipl.-Ing. F. A.Weickmann/Dipl.-Chem. B. HuberDipl.-Ing. H.Weickmann, Dipl.-Phys. Dr. K. Fincke Dipl.-Ing. F. A. Weickmann / Dipl.-Chem. B. Huber

8 MÜNCHEN 86, DEN8 MUNICH 86, DEN

POSTFACH 860 820PO Box 860 820

MÖHLSTRASSE 22, RUFNUMMER 48 3921/22MÖHLSTRASSE 22, CALL NUMBER 48 3921/22

XEROX COEPORATIONXEROX COEPORATION

Rochester, New York 14605, V. St. A.Rochester, New York 14605, V. St. A.

Verfahren und Vorrichtung zur Entwicklung eines elektrostatischen latenten Bildes Method and apparatus for developing an electrostatic latent image

Die Erfindung bezieht sich auf Äbbildungssysteme und insbesondere auf verbesserte Entwicklungssysteme.The invention relates to imaging systems and more particularly to improved development systems.

Die Erzeugung und Entwicklung von Bildern aus einem phatoieitenden Stoff mit Hilfβ elektrostatischer Einrichtungen ist bekannt. Das grundsätzliche elektrophotograpiiißche Verfahren, wie es in der US-Patentschrift 2 2%? 691 angegebenist;,' umfaßt die Aufbringung einer gleichfflisißigein; elektrostetis^Men Üadün^ auf einer photoleitenden Isolierschicht, die Belichtung der Schicht mit Hilfe eines Hell-Dunkel-Bildös, wodurch auf den belichteten Bereichen der Schicht die vorhandene Itadung abgeleitet wird» und die Entwicklung des erzieltest Qlektrostatischen latenten Bildes durch Ablagerung eiaefif fein zerteilten elektro-Qkopischen Stoffes auf dem Bild. Dieser eiektroskopiiehe Stoff wird auf dem vorliegenden Gebiet als "0?oner" beaeichnet. Der loner wird normalerweise von denjenigen Bereichen der SchichtThe production and development of images from a phatoid substance with the aid of electrostatic devices is known. The basic electrophotographic process as described in US Pat. No. 2 2%? 691; electrostetis ^ Men Üadün ^ on a photoconductive insulating layer, the exposure of the layer with the help of a light-dark image, whereby the existing charge is derived from the exposed areas of the layer »and the development of the electrostatic latent image achieved by the deposition of a finely divided electro - Qcopical material in the picture. This electroscopic material is referred to as "0? Oner" in the present field. The ioner is normally from those areas of the layer

BADBATH

000804/1013000804/1013

angezogen, in denen eine Ladung zurückgeblieben ist. Auf diese Weise wird ein dem elektrostatischen latente:] Bild entsprechendes l'onerbild erzeugt. Das betreffende Pulver Itann dann auf eine Träverflache, wie Papier, übertragen werden Das übertragene Bild kann anschließend auf der Trä^erflache dauerhaft fixiert werden, wie durch Wärmeeinwirkung. Anstatt der Erzeugung eines latenten Bildes durch gleichmäßige Aufladung der photoleitenden Schicht und dann erfolgender bildmäßiger Belichtung der betreff enden Schicht kann das latent-; Bild auch dadurch erzeugt werden, dass die erwähnte Schicht J^ entsprechend biidmäßiger Verteilung· direkt aufgeladen wird. Das Pulverbild kann auf der photoleitenden Schicht fixiert werden, sofern es erwünscht ist, den Tonerbild- bzv/. Pulverbild-Übertragungsschritt wegzulassen. Anstelle der zuvor erwähnten Wärmefixierung kann auch mit Hilfe anderer geeigneter Fixiereinrichtungen fixiert werden, wie mit Hilfe eines Lösungsmittels oder durch Behandlung mit einem Überzug.attracted, in which a charge is left behind. In this way, a toner image corresponding to the electrostatic latent image is generated. The powder in question can then be transferred to a carrier surface, such as paper. The transferred image can then be permanently fixed on the carrier surface, such as by the action of heat. Instead of generating a latent image by uniformly charging the photoconductive layer and then image-wise exposure of the layer in question, the latent; Image can also be generated in that the aforementioned layer J ^ is charged directly in accordance with image-wise distribution. The powder image can be fixed on the photoconductive layer, if it is desired, the toner image or. Omit the powder image transfer step. Instead of the above-mentioned heat fixation, it can also be fixed with the aid of other suitable fixing devices, such as with the aid of a solvent or by treatment with a coating.

Zur Aufbringung der elektroskopischen leuchen oder Partikel auf zu entwickelnde elektrostatische latente Bilder sind entsprechende Verfahren bekannt. Zu dieser Gruppe von Verfahren gehören das "Kaßkadierungs^ll--Bitwiöklungsve^;j-fahren;\ wie es in m ' der US-Patentschrift 2 618 552 angegeben ist, das "Mä|netburst en "-Verfahren, wie es in der ÖS-yätentschrifi 2 8^4 065 angegeben ist, und das "Pulverwölken^Verfahren, wie es in der US-Patentschrift 2 221 6?6 jsnlgaigefeen ist, >Appropriate methods are known for applying the electroscopic lights or particles to electrostatic latent images to be developed. This group of processes includes the "Kaßkadierungs ^ll --Bitwiöklungsve ^; j-driving; \ as indicated in m ' of US Pat. yätentschrift 2 8 ^ 4 065, and the "Powder Clouding" method as described in US Pat. No. 2,221,6? 6 jsnlgaigefeen>

Gemäß einem weiteren trockenen Sntwicklungssysteni und gemäß dem trockenen System, eu£ das si-cil die Erfindung weitgehend b e zi eht» erfolgt elfte BötwlclLLüng eines ©1 ekt ro st at is chen latenten Bildes wd.% Hilfe eines Pulverentwicklerstoffes, bei dem das Pulver gleichmäßig auf die Oberfläche einer Pulverabgabeeinrichtung aufgebracht wird· Das latente Bild wird dann dicht genug an die Entwiefclerpulver-AbgabeeinrichtungAccording to a further dry Sntwicklungssysteni and according to the dry system, eu £ the si-cil, the invention largely be zi eht "occurs eleventh BötwlclLLüng a © 1 ect ro st at is chen latent image wd.% Means of a powder developer material, wherein the powder uniformly is applied to the surface of a powder dispenser. The latent image then becomes close enough to the developer powder dispenser

, und zwar-derart, da.", die eine Ladun tragende i?lache das rintwicklerpulver der Abgabeeinriehtun ; entzieht. Uns Bild und die Pulver-Abgabeeinrichtun;; können zur Entwicklu:v ■ in wünschenswerter Weise miteinander in Kontakt gebracht .werden,"einschließlich■dadurch, da. dies unter Druck erfolgt. Die Fulver-Abgabeeinrichtune kann entweder eine glatte Oberfläche oder eine --emusterte Oberfläche besitzen, in welcher -aß Entwicklerpulver von den eingedrückten Bereichen -.aufgenommen ist. Als Beisniel für dieses System seien -die'Verfahr en erwähnt, die in der US-Patentschrift 2 811 465 beschrieben sind., and indeed-like that, there. ", the one carrying a charge i? laugh at the dispensing device's developer powder; withdraws. Us picture and the powder dispensing facility ;; can be used to develop: v Desirably "brought into contact with one another," including by being under pressure. The Fulver dispenser can either have a smooth surface or a patterned surface in which -ass developer powder from the indented areas is. As an example of this system are the methods mentioned in U.S. Patent 2,811,465.

i:in weiteres Verfahren- zur Entwicklung elektrostatischer latenter Bilder ist das Flüssi'-reits-Entwicklun.jsverf ahren, ,v;i« es in der US-Patentschrift 3 064 043 angegeben ist. Bei <ii*se_a Verfahren wird ein elektrostatisches latentes Bild :?eurch entwickelt oder r-iehtbar gemacht, as'-- die Bildfläche cirem flüssigen Entwickler ausgesetzt wird, und zwar von der Oberfläche einen ihtwicklerabgabeteils mit einer Vielzahl von erhöhten Eer-~ich.cn oder "Festba^eiche:;", durch die eine nahezu regelmäßige Oberfläche gebildet ist,- und einer Vielzahl von unterhalb der exhöhten Bereiche liegendei-. eingedrückten Bereichen oder "Tälern". Die eingedruckten. Bereiche enthalten eine Schicht aus leitendem flüssigen Entwickler, der außer Kontakt mit der elektrostatojraphischen Bildfläche -ehalten wird. Das in der erwähnten US-Patentschrift 3 084- 043 an^e-■-.ebene Entwicklungssystem wird nachstehend als "polares. Flüssigkeitsentwicklungs"-System bezeichnet. Dieses Entwicklungssystem unterscheidet sich von konventionellen elektrophoretischen Flüssigkeitsentwicklunftssystemen, bei denen ein nennenswerter Kontakt zwischen dem ,Flüssigkeit«entwickler und geladenen und nicht geladenen Flächen des jeweiligen elektrostatischen latenten Bildes auftritt. Im Unterschied zur elektrophoretischen Entwicklung wird ein nennenswerter Kontakt zwischen der polaren Flüssigkeit und denjenigen Bereichen derAnother method for developing electrostatic latent images is the liquid development process, which is disclosed in US Pat. No. 3,064,043. In <ii * se_a method, an electrostatic latent image is:? E developed or made straightenable 'as' - the image surface is exposed to a liquid developer, namely from the surface a developer release part with a multitude of raised edges. cn or "Festba ^ eiche :;", by which an almost regular surface is formed, - and a multitude of lying beneath the ex-heightened areas. indented areas or "valleys". The imprinted. Areas contain a layer of conductive liquid developer that is kept out of contact with the electrostatographic image area. The plane development system disclosed in the aforementioned US Pat. No. 3,084-043 is hereinafter referred to as the "polar. Liquid development" system. This development system differs from conventional electrophoretic liquid development systems in which there is significant contact between the "liquid" developer and charged and non-charged areas of the respective electrostatic latent image. In contrast to electrophoretic development, there is significant contact between the polar liquid and those areas of the

009884/191 3 . _BAD ORIÖINAL009884/191 3. _B AD ORIOINAL

das elektrostatische latente Bild tragenden Oberfläche, die nicht zu entwickeln sind, vorzugsweise bei dem polaren Flüssigkeitsentwickltinpsveifehren vermieden. Ein verminderter Kontakt zwischen dem flüssigen Entwickler und den Nichtbildbereichen der zu entwickelnden Oberfläche wird deshalb bevorzugt« da auf diese Weise die Bildung von Hintergründabiagerungen vermieden wird. Eine weitere Eigenschaft, die das sogenannte polare Flüssigkeitsentwicklungsverfahren von elektrophoretischen. Verfahren unterscheidet, besteht in der Tatsache, daß die Flüssigkeitsphase eines Entwicklers tatsächlich an der Entwicklung einer Oberfläche teilnimmt. Die Flüssigkeitsphase eines elektrophoretischen flüssigen Entwicklers wirkt dabei nur als iFrägermedium für die Entwicklerteilchen.the surface bearing the electrostatic latent image, which are not to be developed, preferably avoided in the polar liquid development approach. A diminished Contact between the liquid developer and the non-image areas the surface to be developed is therefore preferred « because in this way the formation of background deposits is avoided. Another property that the so-called polar liquid development process from electrophoretic. Method differs, consists in the fact that the liquid phase of a developer is actually at the Participates in the development of a surface. The liquid phase an electrophoretic liquid developer only acts as a carrier medium for the developer particles.

Ein weiteres Entwicklungsverfahren, das als "Benetzungs-Entwicklung" bezeichnet wird, ist in der US-Patentschrift 3 285 beschrieben. Bei diesem Verfahren wird die gesamte Bildfläche gleichmäßig von einem wässrigen Entwickler berührt, und zufolge der ausgewählten Benetzungeeigenschaften und elektrischen Eigenschaften des Entwicklers werden nahezu nur die geladenen Bereiche der Bildfläche von dem Entwickler benetzt. Another development process known as "wetting development" is referred to in U.S. Patent 3,285 described. In this process, the entire image area is evenly touched by an aqueous developer, and consequently the selected wetting properties and electrical properties of the developer, almost only the charged areas of the image area are wetted by the developer.

Alle diese Systeme zeigen eine ausgezeichnete Fähigkeit hinsichtlich der Erzeugung von entwickelten Kopien zufriedenstellender Qualität. Den einzelnen Systemen haften jedoch bei Ausführung in kommerzieller Form verschiedene ernsthafte Schwierigkeiten und liachteile an. Bei den trockenen Entwicklungssystemen müssen relativ große, platzraubende und komplizierte mechanische Einrichtungen verwendet werden, um die jeweilige Entwicklung auszuführen, da nämlich die Entwicklerstoffe der jeweiligen Oberfläche in übermäßig großen Mengen zuzuführen sind, wobei die überschüssigen !!engen des Entwicklerstoffs wieder für weitere Umläufe zur Ausführung folgenderAll of these systems show an excellent ability with regard to the production of developed copies of satisfactory quality. However, the individual systems are liable when carried out in commercial form, several serious ones Difficulties and disadvantages. In the case of the dry development systems, relatively large, bulky and complicated mechanical devices must be used to create the respective To carry out development, namely the developer substances of the respective surface in excessively large quantities are to be supplied, whereby the excess !! tightness of the developer material again for further rounds to execute the following

BAD- ORIGINAL 00988 4/1913 BATHROOM ORIGINAL 00988 4/1913

- 5. ■-■■■■■- 5. ■ - ■■■■■

Entwicklungsoperationen abzuführen sind. Bei einigen dieser Einrichtungen berührt das Entwicklermaterial auch die gesamte ein Bild tragende Oberfläche. Dies führt dann zu Hintergrund- ablagerungen auf dem entwickelten Bild. !Ferner führt die relativ ungehinderte Beweglichkeit des Entwicklerstoffs in derartigen Einrichtungen zu ziemlich unsauberen Entwicklungssystemen. Dabei ist stets die Möglichkeit einer chemischen Verunreinigung des Kopierpapiers, des Photorezeptors (IJichtaufnahmeeinrichtung) oder irgendwelcher mechanischen Einrichtungen vorhanden.Development operations are to be carried out. With some of these Facilities touches the developer material also the entire an image-bearing surface. This then leads to background deposits on the developed image. ! Furthermore, the relatively unhindered mobility of the developer leads to such Institutions to rather unclean development systems. There is always the possibility of chemical contamination the copy paper, the photoreceptor (light receiving device) or any mechanical equipment.

Ähnliche Probleme treten häufig in.Einrichtungen auf, die mit flüssigen Entwieklungssystemen arbeiten. Auch hier kann die gesamte ein Bild tragende Oberfläche von dem flüssigen Entwickler berührt werden, wodurch die Wahrscheinlichkeit unerwünschter Hintergrundablagerungen zunimmt, und ferner werden übermäßige Mengen an Entwickler verwendet. In entsprechender Weise führt die relativ unkontrollierte Bewegung des flüssigen Entwicklers/der jeweiligen Einrichtung zu einer Verschwendung und·zu einem Verspritzen des Entwicklers mit der stets vorhandenen Möglichkeit des chemischen Angriffs einiger mechanischer Teile. Ein besonders bedeutender Effekt der zwanglosen Bewegung des flüssigen Entwicklers kann die Verunreinigung des Kopierpapiervorrats sein»Similar problems are common in facilities that use liquid development systems work. Here, too, the entire image bearing surface will be touched by the liquid developer, reducing the likelihood of undesirable effects Background build-up increases and excessive amounts of developer are used. In appropriate Indeed, the relatively uncontrolled movement of the liquid developer / device leads to waste and · to splashing of the developer with the always existing possibility of chemical attack on some mechanical parts. A particularly significant effect of the casual Movement of the liquid developer can be the contamination of the copy paper supply »

Sowohl bei trockenen als auch bei flüssigen Entwicklungssystemen, jedoch insbesondere bei flüssigen Entwicklungssystemen, befindet sich die Entwicklerabgabefläche normalerweise in durchgehendem Kontakt mit einem Teil der Bildfläche. Wahrend Zeitspannen eines intermittierenden Gebrauchs oder nichtgebrauch^ kann der auf der Abgabeeinrichtung oder -fläche vorhandene Entwickler die Bildfläche chemisch angreifen. Dies führt zu Vertiefungen oder anderen Oberflächendiskontinuitäten, und in dem Fall, daß ein Bindemittelschicht-Photoleiter als Bildfläche verwendet wird, kann der Entwickler sogar vollständig einen Teil des PhotoleitersIn both dry and liquid development systems, however, especially in liquid development systems the developer release surface is usually in a continuous Contact with part of the picture surface. During periods of intermittent use or non-use ^ the developers present on the dispensing device or surface chemically attack the image surface. This leads to deepening or other surface discontinuities, and in the event that a binder layer photoconductor is used as the image surface, the developer can even completely part of the photoconductor

098 84/1913 ' _BAD ORIGINAL098 84/1913 ' _BA D ORIGINAL

zerstören. Bias führt dazu, daß das Entwicklungssystem betriebsunfähig v/ircL Darüber hinaus kann bei jedem Bindemittelschieht-Photoleiter das vorhandene Harzbindemittel auf den durch den Entwickler bewirkten Angriff hin anschließend als Verunreinigungsstoff in dem Entwickler auftreten_P Jeglicher angegriffener oder verdorbene Photoleiterrest kenn ferner auf die Oberfläche der Abgabeeinrichtunc; übertragen werden. Dies führt dann zu einer nicht gleichmäßigen Abrabeoberfläche oder im Falle einer gemusterten Oberfläche zu Ablagerungen in den eingedrückten "Bereichen der Ab-.-ab.eoherfläche. Darüber hinaus kann der unter Drsek erfolgende durchgehende Kontakt wischen der Abgabeoberflächa und dem Photoleiter während längeren iiiehtgebrauehs zur Bildung von flachen Punkten auf einer der Ob©rf!lehm führen _o-destroy. Bias resulting in that the development system inoperable v / IrCl Moreover, the present resin binder out to as contaminant in the developer gets them Bindemittelschieht photoconductor onto the brought about by the developer attack _P Any attacked or corrupted photoconductor rest also indicate to the surface of Abgabeeinrichtunc ; be transmitted. This then leads to a non-uniform abraded surface or, in the case of a patterned surface, to deposits in the indented areas of the abraded surface. Furthermore, the continuous contact between the dispensing surface and the photoconductor during prolonged periods of use can lead to formation from flat points on one of the ob © rf! clay lead _o -

Insbesonders in solchen Systemen, die einen Photoleiter ein einziges Mal oder wiederholt "benutzen_s bereitet.der Umstand Schwierigkeiten, daß der gesamt© geladene Bereich des Photoleiters, der größer sein kann als der Bilctfce-il, entwickelt wird und daß jede damit erhielte Kopie abgelagerten oder übertragenen Entwickler auch in anderen Bereich als den Bildbereichen aufvieisen kann«In particular, in such systems, which repeats a photoconductor once or _s use "bereitet.der circumstance difficulties that the total © charged area of the photoconductor, which may be greater is than the Bilctfce-il, develops and that any order would receive copy deposited or transferred developer can also show in areas other than the image areas «

Ss dürfte somit einzusehen sein_$ daß eine ständige !Forderung nach einem besseren System zur Entwicklung elektrostatischer latenter Bilder vorhanden ist«,Ss should thus be appreciated that a permanent _$! Demand for a better system in place for developing electrostatic latent images "

Der Erfindung liegt dah©r die Aufgab© am Grunde, ein Entwicklungssystem zu schaffen _t das. die oben auf«:© zeigt en Schwierigkeiten überwindet« Das neu zu schaffende !Entwicklungssystem soll dabei einfach uad kompakt s®in_o Außerdem soll bei dem neu zu schaffenden Entwicklungssystem eine Bntwicklerabf^abeoberfläche nahezu nur denjenigen Bildbereich auf der jeweiligen Bildobe-:·- flache zu berühren vermögen,"der .au entwickeln ist» DarüberThe invention is dah © r who abandoned © at the base, a development system to create _t the link to "above. Overcomes © shows s trouble," The newly created development system is intended to simply uad compact s®in _o In addition to in the new! Development system to be created has a developer application surface almost only that image area on the respective image surface: · - Ability to touch flat areas, "which is to be developed" Above

00 9 8 84/191300 9 8 84/1913

BADORIQiNALBADORIQiNAL

.hinaus soll las neu zu schaffende Entwicklungssystem ein bewegliches modulares Entwicklungssystem sein. Dabei soll insbesondere ein zurückziehbares Entwieklerabgabesystem VO.gesehen werden. Das neu zu schaffende Entwicklungssystem soll im übrigen sauberer arbeiten als die bisher bekannten äntwicl-lun^ssysteme. Außerdem soll das neu zu schaffende ^twicklunrssystem Bilder zu erzeugen gestatten _y die sich durch verminderte HinterKrundablagerungen auszeichnen. Im übrigensoll der Sntwicklerverbrauch herAbgesetzt werden. Ferner sollen bei dem neu zu schaffendenEntwicklungssystem geringere Anforderungen bezüglich derWartung bestehen* Außer- ™ öem soll das neu zu schaffende Entwicklungssystem imstande sein, eine^^ kontinuierliehe IbitwiGklung euszuführeft.^ferner soll bei dem neu zu schaffende Entwicklungssystem fiia? eine ivontinuierliche Entwicklunf, ein kleiner oder überhaunt kein linearer kummulativer Fehler in dem Entwicklungszyklus auftreten. Schließlich soll das neu zu schaffende EntwicklunES-system ^e-enüber den bekannten Entwicklunrssystemen uberleren sein«In addition, the newly created development system should be a movable modular development system. In particular, a retractable development levy system VO. Should be seen. The new development system to be created is to work more cleanly than the previously known development systems. In addition, the newly created ^ twicklunrssystem images to generate allow _y which are characterized by reduced HinterKrundablagerungen. By the way, the developer consumption should be reduced. In addition, the newly created development system should have lower maintenance requirements a continuous development, a small or mostly no linear cumulative error occur in the development cycle. Finally, the new development system to be created should be overlaid on the known development systems "

Die vorstehend aufgezeigte Aufgabe wird {renereil gesagt erf in dungs g-emäß durch ein 3üitwicklungssystem mit einem Sntwiciclermodui gelöst, das aus einer Stellung zurückziehbar ist, J in der es mit der elektrostatoc-raphischen Bildfläche in Entwicklungsberührung steht und das durch eine weitgehend ge- schlossene, selbständige, kompakte Einheit gebildet ist·, die Außenflächen nur in den Fällen ausgesetzt ist, in denen es erforderlich ist. Das Abgabemodul enthalt insbesondere in seinem Innern ein System zur Abgabe von Entwicklermaterial an eine Abgabeoberflache und ein Abstreichsystem, mit dessen Hilfe abgemessene Entwicklermengen in abgestrichener IForm auf die Abgabeoberfläche abgegeben werden. Die Abgabeeinrichtung in dem Entwicklermodul ist durch eine Oberflächefestlegende Bahn gebildet, über deren einen Teil das Entwicklermodul zurThe above task is said {renereil according to the invention by a 3üitwicklungssystem with a Sntwiclermodui released, which is retractable from a position in which it is in development contact with the electrostatographic image area and that through a largely closed, independent, compact unit is formed · the external surfaces are exposed only in those cases in which it is is required. The delivery module contains in particular a system for dispensing developer material inside a dispensing surface and a scraping system with the help of which measured amounts of developer in streaked I-form on the Dispensing surface are delivered. The delivery facility in the developer module is defined by a surface specification Formed web, over a part of which the developer module to

009884/1913 >ad009884/1913> ad

Außenseite hin off en istund damit eineEntwicklüngsbe- _: rührung mit der jeweiligen; ein Bild, tragenden Oberfläche ermöglicht. Sämtliche Elemente in dem Entwicklermödul sind sicher aber beweglich in ifceer erförderliöhen Konfiguration angeordnet, wobei diöse Anordnung bizwν Ausrichtung tier Elemente ständig beibehalten wird. Das gesamte. Entwicklermodul ist auf einer Welle drehbar gelagert, die in Jiängsrichtung des Sntwicklermodüli» νerlauft * Außerdem ist das Entwickl ermodul durch Federkraft derart belastetj daß sich die Abgabeöberfläche mit der JPhotoleiitierpberflache^ zur 'Btitwicklune in Berührung befindet, Sie Entwicklungsberührung ist dadurch aufhebbsr, da^ das Entwipklermodul von der Oberfiäch© der Bildfliehe zurückgezogen wijfd·Ciiierzu dienen irgendwelche geeigneten Sinrlchtungen^ wi« ieine Hocke^ die in einer solchen Weise verwendet wird, daß ües Entwicklermodul sich nur auf einer bestimmten Bahn der Bildfläche befindet. Dies bedeutet» daß die ^twicklerabgabeeinrichtung in demaeftigen Teil der Photoleiterbahn aus der Entwicklungsstellung zurückziehbar ist, der kein zu entwickelndes elektrostatisches latentes Bild trägt. Die Entwickleräb§aheeinrichtung befindet sich in der Entwicklüngsεteilung bzw* in der Entwicklungsberührungsstellung nahezu nur dann, wenn der ein zu entwickelndes Bild tragende Teil der Photoleiterbahn sich ebenfalls in der Entwicklungsstellung oder -berührungsstellung befindet.The outside off en istund so _{eineEntwicklüngsbe-:} agitation with the respective; an image that enables load-bearing surface. All elements in the developer module are securely but movably arranged in the required configuration, with the dious arrangement or alignment of the elements being constantly maintained. The entire. The developer module is rotatably mounted on a shaft which runs in the longitudinal direction of the developer module. In addition, the developer module is loaded by spring force in such a way that the delivery surface is in contact with the photoleiiting surface for the development of the process, and the development module is thereby canceled withdrawn from the surface of the image flea, some suitable devices, such as a crouch, are used in such a way that the developer module is only located on a certain path of the image area. This means that the developer delivery device can be withdrawn from the development position in that part of the photoconductor web which does not carry an electrostatic latent image to be developed. The developer attachment device is located in the development division or in the development contact position almost only when the part of the photoconductor track carrying an image to be developed is also in the development position or development contact position.

An Hand von Zeichnungen wird die Erfindung nachstehend näher erläutert.The invention is explained in more detail below with reference to drawings explained.

Pie. 1 zeigt in einer Stirnansicht eine Ausfuhrungsform der vorliegenden Erfindung bei entfernter Stirnplatte.Pie. 1 shows an embodiment of FIG present invention with the faceplate removed.

Figr. 2 und 3 zeigen St im an sieht en anderer Ausführungsformen gemäß der Erfindung.Figr. 2 and 3 show St in other embodiments according to the invention.

Fig. 4 zeigt ir. einer Ferspektivansicht eine Ausführungsform gemäß der Erfindung.4 shows an embodiment in a perspective view according to the invention.

BAD ORIGINAL 009884/.1913 BATH ORIGINAL 009884 / .1913

Fig. 5 zeigt schematisch einekonventionelle mechanische Programmiereinrichtung gemäß der Erfindung.Fig. 5 shows schematically a conventional mechanical one Programming device according to the invention.

In Fig. 1 ist das Entwicklermodul generell mit 16 bezeichnet; es enthält einen Entwicklertrog oder ein Entwicklergehäuse 11, das aus einem Stück bestehen kann. Der Entwicklertrog 11 kann z.B. ein.gespritzter Aluminiumtrog sein. Eine Entwicklerabdeekung 12 stellt die obere Abdeckung des Entwicklermoduls dar; sie ist an den Stirnplatten (nicht gezeigt) des Entwicklermoduls mittels zweier oder mehrerer Schrauben 13 und 14- sicher befestigt. Die (nicht dargestellten) Stirnplatten sind an dem c Entwicklertrog 11 mittels Schrauben 15 an jedem Ende des Entwicklertroges befestigt. In dem Entwicklertrog ist eine Entwicklerabgabewalze 16 drehbar angeordnet, und zwar um ihre Längsachse, die durch ein in jeder Stirnplatte vorgesehenes Lager hindurehläuft. In dem Entwicklertrog ist eine Zuführwalze17 drehbar um ihre Längsachse ia Lagernin den Stirnplatten gelagert» Auf einem tragarm 19 des Entwicklertroges oder -gehäuses 11 ist ein Kanten-? und . Bcken- Ab st reif blatt 18 angeordnet, und zwar mittels irgendwelcher göeigiseten Einrichtungen , wie durch eine Schraube 38* Ein HauBir-Abatreichblatt i0t dabei an einem Oiragteil 21 mittels eines itlews® t& befestigt, welch© mittels Schrauben 23 in iiiri^ liag© festgehalten '" -.% wird. Der Abstreichblattträger 21 ist Bittsls Schrauben 25 JJda der Schwenkwelle 24 befe at igt. Bisf S ciweäkw^lis ^ igt an iiiren Enden zylindrisch atisgebildöt, um i^ den Stfiraiiif^tea eine l· iSchwenkbewfgung ausführen zu können"! die Schwöäkwelle iöt debei durch federkraft mittels einer Maohfeeiei* 26 in ihrer Γ Lage entspi?echQna belastet. Mittels* eiäe^ EiesteXlsotoÄube 2f kann dabei Γ eine y@rsteilbare Spannung vorgöSf ilien sein. Das Bnt-*, wicklermateri&i wird dem Bad oder ?o£ratstei| (LM^ Entwickl©!'-tröges 28 mittels einer Rohrleitung 29 ssugöführt _v die an einer größeren Entwicklerspeiseeinrichtung angeordnet ist. Der Entwickler kann dem Bad oder Vorratsteil des BntwickXertrogesIn Figure 1, the developer module is indicated generally at 16; it contains a developer trough or a developer housing 11, which can consist of one piece. The developer trough 11 can, for example, be an injection-molded aluminum trough. A developer cover 12 is the top cover of the developer module; it is securely attached to the front plates (not shown) of the developer module by means of two or more screws 13 and 14-. The face plates (not shown) are attached to the developer trough 11 by means of screws 15 at each end of the developer trough. A developer delivery roller 16 is rotatably arranged in the developer trough, specifically about its longitudinal axis, which runs through a bearing provided in each end plate. In the developer trough a feed roller 17 is rotatably mounted around its longitudinal axis, generally bearings in the end plates. On a support arm 19 of the developer trough or housing 11 is an edge? and . Bcken-Ab st reifblatt 18 arranged, namely by means of any göeigiseten devices, such as by a screw 38 * A HauBir-Abatreichblatt i0t attached to an Oiragteil 21 by means of an itlews® t & , which © by means of screws 23 in iiiri ^ liag © '. "-.%, the Abstreichblattträger 21 is Bittsls screws 25 JJda the pivot shaft 24 BEFE at IGT BISF S ciweäkw ^ lis ^ IGT atisgebildöt cylindrical at iiiren ends to i ^ the Stfiraiiif ^ tea to run a length iSchwenkbewfgung." ! the Schwöäkwelle iöt debei stressed by spring force by means of a Maohfeeiei * 26 in its Γ position accordingly. By means of * eiäe ^ EiesteXlsotoÄube 2f , a y @ divisible voltage can be predicted. The Bnt- *, Wicklermateri & i is the bath or? O £ ratstei | (LM Entwickl ^ © '- tröges 28 by a pipe 29 ssugöführt _v which is disposed at a larger developer feeding device The developer may bath or reservoir part of the BntwickXertroges.

4/1 91 3 ,badoriginal4/1 91 3, bad original

vorzugsweise durch Schwerkraft-Zufuhreinrichtungen zugeführt werden. Das Entwicklermodul 10 wird in einer den Photoleiter 31 berührenden Entwicklung^ stellung gehalten, der hier als Bahn, Band oder folattartiger Photoleitex dargestellt ist, welcher durch Tragrollen oder -walzen 32 in seiner Lage gehalten wird, und zwar mittels einer Blattfeder 30, die unter Ausübung einer entsprechenden Spannung die Stirnplatte 33 berührt, welche mittels Schrauben 15 an dem Sntwicklertrog 15 fest angeordnet ist«, Der obere Teil der Stirnplatte 33 stellt die Nockenaufnahmefläeh© für die Nocke 35 dar, die auf.ihre Drehung hin die Nockenfläche berührt und damit das Entwicklermodul um dessen Schwenkungs- oder Drehv/elle dreht. Bei dieser Welle kann es sich um einen Ansatz der Zufuhrwalzenwelle handeln. Neben dieser Funktion vermag die Hocke auf ihre Drehung hin und unter Berührung der Hockenfliehe die Abgabefläche aus der Entwicklüngsberührungsstellung her&us. zuführen* Pur diesen Zweck kann eine einfache Boeder und/oder Koeke verwendet werden. Um ©inen gleichmäßigen B/ruckkontsikt sicherzustellen, werden vorzugsweise an jedem Ende des Entwicklermoduls Federn verwendet. In entsprechender Weise können zwei Hocken verwendet werden« Bas Entwicklennodul ist in dem Gesamtmaschinengebilde drehbar angeordnet> um die beschriebene Einstellung bzw. Trennung der Abgabeflache i£ Basug auf die Bildfläche zu bewirken.preferably fed by gravity feeders. The developer module 10 is in one of the Photoconductor 31 touching development ^ position held, which is shown here as a web, ribbon or folate-like photoleitex is, which is held in its position by support rollers or rollers 32, by means of a leaf spring 30, which, while exercising a corresponding tension, touches the face plate 33, which is attached to the developer trough by means of screws 15 15 is firmly arranged «, the upper part of the faceplate 33 represents the cam receiving surface © for the cam 35 which their rotation touches the cam surface and thus the Developer module rotates around its swivel or rotary level. This shaft can be a shoulder of the feed roller shaft Act. In addition to this function, the crouch can be used their rotation towards and with contact of the squat flies the delivery surface from the development contact position. respectively* For this purpose a simple Boeder and / or Koeke are used. In order to maintain an even b / r back contsict ensure that they are preferably at each end of the developer module Springs used. Two squats can be used in a corresponding manner «Bas development module is in the Entire machine structure arranged to be rotatable> around the described setting or separation of the dispensing area i £ Basug on the To effect image area.

Bei der in SIg, 1 dargestellten Ausitifcruagsform kaün die Photoleiterbahn durch irgendeine herkömmliche Einrichtung aufgeladen und einem zu reproduzierenden Bild entsprechend belichtet? werdea, um auf dem Photöleiter ein elektrostatisches latentes Bild zu erzeugen. Während desLaaeschrittös kann das Abgebemodul, das dabei von der Entwicklungsetelle «regeführt ist, durch irgendein geeignetes mechanisches Programmierest ein betätigt werden, um die Abgabeoberfläche mit Entwickler zu versehen. Während der betreffenden Aufträgoperation und weiterhinIn the case of the Ausitifcruagsform shown in SIg, 1 the Photoconductor line by any conventional means charged and corresponding to an image to be reproduced exposed? there will be an electrostatic on the photoconductor generate latent image. During the Laaeschrittös can A delivery module, which is introduced by the development department, by any suitable mechanical programming remainder actuated to apply developer to the dispensing surface. During the relevant job operation and further on

BAD-ORIGiNALORIGINAL BATHROOM

00 9084/191300 9084/1913

des Entwicklungzyklu^ ^
füb,rwslze oder -rolle, diesich mit der Abgabewalze in der ButwiCiaerübertreiginofstelluniv befindet, den Entwickler aus dem Sntwicklerbad an die Oberfläche der sich drehenden Abgabe« walze bzw* -rolle ab» Ba bei dieser Aueführungsform der Sntrwickler auf der AbgrabeoberflScne in niciat gleicnmäßiger form vorhanden ist, wird die Abgäbeoberfläcne zunächst mit Kanten«. und Seken-Abstrelf flächenund dann iait einer Hauptabstreichf !Sehe jabgestrielien, die 0icli libör die gesaaite LSnse der Äbgebefläcbte erstreckt* Die die Abjgabefltofae* welche sbgemeseefte JEntwicklerjaengen in abgestrichötter Ifcrin entfctltv testlegende Bahn wird sodann au der Ent^icklungsstellung hin geführt*of the development cycle ^ ^
füb, rwslze or -roll, which is located with the delivery roller in the ButwiCiaerüberüberreiginofstelluniv, the developer from the developer bath on the surface of the rotating delivery "roller or * roller from" Ba in this embodiment, the developer is not present on the excavation surface in the same form is, the Abgaboberfläcne is initially with edges «. and Seken-Abstrelf surfaces and then iait a main scraper! See jabgestrielien, which extends the stringed eyes of the Abjgabefläcbte.

Während der Belichtungdes geladenen thotolelters kann das rrograminiersyötefm die Beschickung der Abgabefläche unter'-brecheii, da vorzugsweise sämtliche Bewegungen angehalten werden _f um sicherzustellen, da£ auf dem Photoleiter Bilder bester Schärfe erzielt werden« Hach erfolgter Belichtung führt das Prograsimiersystem denjenigen 3?eil des Photoleiters, der ein zu entwickelndes Bild trilgfc, zum Swecke der Entwicklung zu der Abgabeflache hin, währepddegsen gleichzeitig das JEntwickler* modul wieder bjetätigi: wird, S^During the Belichtungdes charged thotolelters can rrograminiersyötefm the feeding of the release area unter'-brecheii because preferably all movements _f be stopped to ensure there £ be obtained on the photoconductor images of best focus, "Hach successful exposure leads the Prograsimiersystem those three? Ecause of the photoconductor , which trilgfc an image to be developed, to the swecke of the development towards the delivery area, would be at the same time the developer module again bjetätigi: S ^

reichs des PhötöleiterS jsiöh 4er Stelle ISnps der iragwalze 52 nähert, an der die Entwicklungempire of the PhötöleiterS jsiöh 4th place ISnps of the iragwalze 52 approaching the development

spätem die Hocke in eine solche Xage, 'iÄ-^#r--'d^e"-i«d«^:3p^v'|Ö," dös. Abgabemodul in'^ die^ Ba^^twicklungöstellung mit der iTorderkante des zu entwickelkden Bildes zu bringen iastände- ist* in t^ischef Weise steuert die Programmiereinrichtuns das Programm* oder Programmiersystein., und ferner werden sämtliche Zyklen durch die Programmiereinrichtung ausgelöst, indem die Iiange'" döt Lichtaufnahmeflache bzw, des Photorezeptors überwacht wird, die an einer Stelle neben der Laaestation vorbeiläuft, und zwar in der Weise, da-· in der Entwicklungsstufe das Entwicklermodul die Entwicklungseinstellung zu dem Photoleiter längs derlater crouch in such a xage, 'iÄ - ^ # r -' d ^ e "-i« d « ^: 3p ^v '| Ö," dös. To bring the delivery module into the development position with the order edge of the image to be developed, the programming device controls the program or programming system in this way, and all cycles are triggered by the programming device by using the For a long time the light receiving surface or the photoreceptor is monitored, which passes a point next to the loading station, in such a way that in the development stage the developer module adjusts the development to the photoconductor along the

009884/1913 BAD ORIGINAL009884/1913 ORIGINAL BATHROOM

2031520315

Vorderkante des zu entwickelnden Bildes beginnt. Der Photoleiter und die Abgabefläche setzen unter Beibehaltung der Entwicklung einstellung ihre Bewegung solange fort, bis das gesamte Bild entwickelt ist. Ist die Entwicklung abgeschlossen, so betätigt die ProgrammiereinricSatunß den tiockenmechanismus, um das gesamte Entwicklermodul um dessen Schwenkungswelle zu schwenken und damit zurückzuziehen. Sofern·erwünscht, kann das entwickelte Bild auf Kopierpapier$6 übertragen werden, das in einer.Übertragungsstellung durch die Aufnahmerolle oder -walze gehalten ist. Die mechanische Programmiereinrichtung kann ferner so ausgebildet sein, daß die Entwicklunrseinstellungzwischen dem Photoleiter und der Abgabefläche des Entwicklerinoduls über irgendeine bestimmte Länge desPhotoleiters erzielt wird. Aus vorstehend näher ausgeführten Gründen wird jedoch bevorzugt, eine mechanische Programmiereinrichtung zu verwenden, mit deren Hilf© eine bestimmte Länge der Entwieklungseinstellung erzielt wird, die nahezu gleich der Länge des zu entwickelnden Bildes ist.The leading edge of the image to be developed begins. The photoconductor and the delivery surface continue their movement while maintaining the development setting until the entire image is developed. When the development is finished, the programming device actuates the drying mechanism, to swivel the entire developer module around its swivel shaft and thus retract it. If desired, it can developed image can be transferred to copy paper $ 6, which is in a transfer position by the take-up roller or roller is held. The mechanical programmer may also be adapted to allow the developer setting between the photoconductor and the release surface of the developer module any particular length of photoconductor is achieved. the end For reasons detailed above, however, it is preferred to use a mechanical programmer with whose help © a certain length of the development setting which is almost equal to the length of the image to be developed.

Die erwähnte mechanische Programmiereinrichtting kann irgendeine Einrichtung sein, die genau und wiederholt eine aufeinanderfolgende Zeitsteuerung und Synchronisierung sämtlicher Vorgänge vorzunehmen erlaubt, die bei dem Verfahren und in dem Maschinensystem erforderlich sind, Dabei- kann a'ede geeignete Einrichtung für die Realisierung dieses Mechanismus verwendet werden. Die mechanische Programmiereinrichtung kann z.B. eine einfache Einrichtung enthalten, die sich mit einer konstanten Drehgeschwindigkeit dreht und die in verschiedenen Bereichen innerhalb eines vollständigen Umlaufs vorgesehene Einstellelemente in Tätigkeit setzt, und zwar derart, daß auf die Vervollständigung eines Umlaufs der Programmiereinrichtung hin sämtliche Tätigkeiten bzw. Vorgänge der Reihe nach ausgeführt sind. Die den einzelnen Vorgängen zugehörigen Einstellelemente können in irgendeiner ϊοπη ausgebildet sein, um die erforderlicheThe mentioned mechanical programming device can be any device which accurately and repeats a sequential one Time control and synchronization of all Allow operations to be carried out that are required in the process and in the machine system, any suitable Facility used for realizing this mechanism will. For example, the mechanical programming device may include a simple device that deals with a constant Rotational speed rotates and the setting elements provided in different areas within a complete revolution sets in action in such a way that upon completion of a cycle of the programmer all activities or processes have been carried out in sequence. The setting elements associated with the individual processes can be designed in any way to achieve the required

BAD ORIGINAL 00988 4/1913BAD ORIGINAL 00988 4/1913

zeitliche Folge von Operationen sowie sum jeweils geeigneten Zeitpunkt die Einstellung bzw. Aufhebung der jeweiligen Operation zu bewirken. Sine typische mechanische Programmier- ' einrichtung enthält eine Reihe von Zahnrädern, die von der Photoleiter-Papierzuführeinrichtung bis zu der Photoleiter-Stützrolle bzw. -walze und zu einem auf der nockenwelle ange- · ordneten Zahnrad verlaufen. Die Unten- bzw. Druckfarbenwalze und die Entwicklerwalze können ebenfalls von der gleichen Zahnradfolge oder aber auch unabhängig davon angetrieben werden. Die Übersetzungsverhältnisse der Zahnräder in der Zahnradfolge können in typischer Vfeise so gewählt sein, daß die Hocke zu ■ sämtlichen Zeitpunkten .sich in einer anderen Einstellung befindet als in dem Pail, daß sich die Abgabewalze mit einer bildtragenden Oberfläche in einer Entwicklungsstellung bzw. -einstellung befindet. Obwohl eine mechanische ZeitSteuerung bevorzugt wird» und zwar zur Minimisierung von Fehlern und insbesondere von kummulativen Fehlern über eine Zeitperiode hinweg, sei bemerkt, daß auch elektrische oder elektromagnetische Zeitsteuermechanismen verwendet werden können. Eine typische elektromagnetische Einrichtung enthält ein Magnetrelais, wie dies Fig. 2 veranschaulicht.time sequence of operations as well as sum appropriate in each case Time the setting or cancellation of the respective Effect surgery. Its typical mechanical programming ' device contains a series of gears that run from the photoconductor paper feeder to the photoconductor support roller or roller and one attached to the camshaft arranged gear run. The bottom or printing ink roller and the developer roller can also be of the same gear train or they can also be driven independently. The gear ratios of the gears in the gear train can typically be chosen in such a way that the crouch is neat all times. is in a different setting than in the pail that the delivery roller with a image-bearing surface in a development position or setting is located. Although a mechanical time control preference is given to »to minimize errors and especially of cumulative errors over a period of time, it should be noted that electrical or electromagnetic Timing mechanisms can be used. A typical one electromagnetic device contains a magnetic relay, as illustrated in FIG.

In Fig. 2 ist eine weitere Ausführungsform gezeigt^ die von j der in Fig. 1 dargestellten Ausführungsform sich, durch die Verwendung eines trommeiförmigen Photoleiters/ lade-, Belichtungs-,Bildubertragungs- und unterscheidet. Die in Fig. 2 dargestellte Ausführuagsfortn scheidet sich von der in Fig. Λ dargestellten Ausführungsform ferner durch die Verwendung einer Walzenabstreicheinrichtung (in Fig. 1 sind Blattabstreifeinrichtungen vorgesehen) und durch die Verwendung eines Magnetrelais zur Freigabe des Entwieklermoduls. Das Entwicklermodul enthält insbesondere einen Entwicklertrog oder ein Entwicklergehäuse 40 zusammen mit einer Abdeckung 41, die mittels einer Klemme 42 und mittelsFIG. 2 shows a further embodiment which differs from the embodiment shown in FIG. 1 by the use of a drum-shaped photoconductor / charging, exposure, image transmission and transmission. The embodiment shown in Fig. 2 differs from the embodiment shown in Fig. Λ also by the use of a roller scraper (in Fig. 1 sheet scraper devices are provided) and by the use of a magnetic relay to release the decelerator module. The developer module contains in particular a developer trough or a developer housing 40 together with a cover 41, which by means of a clamp 42 and by means of

BAD ORIGINAL 009884/1913 - ORIGINAL BATHROOM 009884/1913 -

031500031500

Schrauben 4J an dem Gehäuse festgehalten wird«, Auf diese Weise ist ein weitgehend geschlossenes modulares System gebildet« In den an jedem Snde des Sntwioklertroges "befestigten (nicht dargestellten) Stirziplafcten sind eine Ab^abewalze 44 > eine Zuführwalze 45 und eine Ibstreifwalze 46 drehbar gelagert. Das Magnetrelais 47 ist so angeordnet, daß es die Aufnahmefläche der Stirnplatte 48 anzuziehen vermag« Das Entwicklermodul 49 wird mittels einer Feder 50 iⁿ der EntwicklunKS-stellung gehalten. Mährend des Betriebs kann Entwickler¹ mittels der Rohrleitung 51 in das kleine Bad in dem Entwickle lermodul eingeführt werden» Der auf der Oberfläche der Trommel 56 befindlich© Photoleiter wird an der Ladestation 52 aufgeladen und an der Belichtung station 53 belichtet* Das auf dem Photoleiter befindliche latente Bild wird entwickelt, wenn die Abgabeoberfläche des Sntwicklermoduls sieh an der Intwicklungsstation 58 in der jSntwicklungs eins teilung befindet« Das entwickelte Bild kann dann auf Kopierpapier 54 übertragen werden, indem das betreffende Papier und das entwickelte Bild mit Hilfe einer Druckrolle 55 in der Ubertragungsanordiiung zusammengeführt werden» Die Oberfläche des Phötöleitiörs 56 kann anschließend an der Keinigungsstation 5? gereinigt werden. Die bei dieser Ausführungsform benutzte AbsijreifwslZie oder ~rplle ^ " kann eine Botteibenwischei?äi?feige jk»llenabst?0ifeiijri.chtti|i|i oder ^ eine "kuf enförmiga¹* Rollehabstreif"einrichtung: seilt*Is held screws 4J to the housing "In this way is formed a substantially closed modular system" in the fixed (not shown) at each sin of Sntwioklertroges "Stirziplafcten a Ab ^ are abewalze 44> a feed roller 45 and a Ibstreifwal ze 46 rotatably stored. the solenoid 47 is arranged such that it is able to attract the recording surface of the end plate 48 ', the developer module 49 Mährend by means of a spring 50 i of EntwicklunKS position ⁿ held. of operation can developer ¹ by means of the pipe 51 in the small bathroom in The photoconductor located on the surface of the drum 56 is charged at the charging station 52 and exposed at the exposure station 53 in the development division is «The developed image can then be au f copy paper 54 can be transferred in that the paper in question and the developed image are brought together with the aid of a pressure roller 55 in the transfer arrangement. getting cleaned. The AbsijreifwslZie or ~ ^ rplle used in this embodiment "? Can be a Botteibenwischei ai cowardly jk" llenabst 0ifeiijri.chtti | i | i ^ or one? "Kuf enförmiga ¹ * Rollehabstreif" university: abseil *

In Jig» 3 ist eine weitern Ausführtpigsförjnfe dargestellt, bei der sowohl die BQtwioklerz.ii|iihrung zu der Abgabeoberfläche als auch das Abstreifen der Abgabeoberfläche mit Hilfe sin und derselben Oberfläche oder. Einrichtung erreicht wird. Dabei führt nämlich insbesondere eine Walζ,θ 60 beide Funktionen aus (wie dies an anderer Stelle bereits vorgeschlagen worden ist)_c Das Abgabemodul 69 besteht dabei insbesondere aus einem Entwicklertrog oder -gehäuse 62, dar b%t$« das aus einem Stück gebildet sein kann. An jeder^ Seite des GehäusesAnother embodiment is shown in Figure 3, in which both the process of contact with the release surface and the wiping of the release surface with the aid of the same surface or. Establishment is achieved. In this case, namely, leads, in particular a Wal ζ, θ 60 both functions (as has already been suggested elsewhere) _c The dispensing module 69 consists in particular of a developer trough or housing 62, is b% t $ «the formed integrally can be. On each ^ side of the case

0 9884/1913 bad original0 9884/1913 bad original

; ■; .. Stirnnlatten 63 angeordnet, und innerhalb der Stim- :;!,·'c ten ist eine Zufuhr- und Ab st reif walze 60 drehbar angeo ■ r.et, die in einer Zufuhr- und Abstreifstellung zu der Arir^bewalze 61 .,steht. Von außen her zugeführter Entwickler kr*r,n durch die Rohrleitung 65 in dem Entwickiermodul aufgenommen werden. Das Entwiclrlermodul ist hier in einer Stellung ■RozoiRt, in der es aus der Entwicklungstellung herausgeführt iöt. Erreicht wird dies mittels einer Kocke 6^, die auf die 'socken aufnahmefläche der St implatt en 65 wirkt. Ist das Ent-Wicklermodul in die aitwic;;lui3r*sstellung gebracht, so wird der ein zu entwickelndes Bild tragende FJiotoleiter 6? ¥on der Tragwalze oder -rolle 66 getragen, da eine Sehrattbenfeuer 66 die ©rfelterliche..Kraftausübt, um das iäitwicklerin die Entwicklungseteilung zu bringen, *; ■; .. end laths 63 arranged, and within the face :;!, · 'C ten is a feed and discharge roller 60 rotatably attached ■ r.et, which is in a feeding and stripping position to the Arir ^ bewalze 61., Stands. Developer supplied from outside kr * r, n can be received through the conduit 65 in the developing module. The developer module is in one position here ■ RozoiRt, in which it led out of the development position iöt. This is achieved by means of a cam 6 ^, which is on the 'socks receiving surface of the St implatt en 65 acts. Is the unwinder module brought into the aitwic ;; lui3r * position, then the FJio conductor 6 carrying an image to be developed? ¥ on carried by the support roller or roller 66, as a Sehrattbenfeuer 66 who exercises the power to develop to bring the development sharing, *

In Fig.. 4 ist in einer Perspektiyansicht die in S¹Ig* 1 dargestellte AusführungsfonB der Erf indunr; wieder-jegeben. Babel ist gezöigt, daß die Abrraberolle bzw. -waläe 72 um ihre Iiänrsschse ?4 drehbar in den Stij-nplatten 73 -elagert ist, und zwar in entsprechend befestigten liagern 75» Die Ab^abewalze 72 kann mit Hilfe nicht näher dargestellte?Mnrichtimgen über das Sahnrad 76 angetrieben werden. Die Suführrolle bzw· -walze ist um ihre Längsachse 77 . iß den Stirnplatten 73 drehbar ge-^ lagert und von Lagern 78 aufgenommen. Das Sahnrad 79 wird von einer eicternen Einrichtung her angetrieben. An den Stimplatten 75 ist eine Abdeckung 80 mittels Schrauben 61 befestigt, und die Stirnplatten 75 sind ihrerseits an dem Efitwicklertrog mit Hilfe von selbstschneidenden Schrauben 82 befestigt. Auf dieser Weise ist ein weitgehend verschlossenes Entwicklermodul geschaffen. Die Hauptabstreifblatt-Schwenkungswelle 83 ist dabei in Lagern 84 in den Stirnplatten 73 befestigt. Die- Kocke 85 ist auf der Welle 86 drehbar angeordnet, die ihrerseits an einem feststehenden äußeren Teil befestigt ist, wie an einem Maschinenrahmen. Auf entsprechende BetätigungIn Fig. 4, the ^{embodiment shown in S 1} Ig * 1 of the invention is in a perspective view; again-given. Babel is hesitant that the Abraberolle or -waläe 72 is rotatably mounted about its Iiänrsschse? 4 in the pin plates 73 , and that in appropriately attached bearings 75. The Abrwalze 72 can with the help of not shown measurements over the cog wheel 76 are driven. The feed roller or roller is about its longitudinal axis 77. The end plates 73 are rotatably supported and received by bearings 78. The cog wheel 79 is driven by an internal device. A cover 80 is fastened to the end plates 75 by means of screws 61, and the end plates 75 are in turn fastened to the efit wrapper with the help of self-tapping screws 82. In this way, a largely closed developer module is created. The main scraper blade pivot shaft 83 is fastened in bearings 84 in the end plates 73. The cam 85 is rotatably mounted on the shaft 86, which in turn is attached to a fixed outer part, such as a machine frame. Upon appropriate actuation

'BAD ORlGlHAL 009 8-84/ 1 9Ί 3 . 'BAD ORlGlHAL 009 8-84 / 1 9Ί 3.

hin dreht sich die Kocke 85 um die Welle 86 und berührt dabei die Nockenaufnahme- bzw. Hockenanlageflache 87. Die an die bildtragende Oberfläche andrückbare Druckwalze 88 ist auf einer Welle 89 drehbar'gelagert; sie kann von einer externen Antriebsquelle über das Zahnrad 90 angetrieben werden. Im Betrieb können die Druckwalze 88, die Bntwicklermodul-Schwenkungswelle 77 und die Nockenwelle 86 in einer festen Rahmenanordnung fest angeordnet sein.the cam 85 rotates around the shaft 86 and touches the cam receiving or crouching contact surface 87. The pressure roller 88, which can be pressed against the image-bearing surface, is rotatably mounted on a shaft 89; it can be driven by an external drive source via the gear 90. In operation, the platen 88, developer module pivot shaft 77, and camshaft 86 can be fixedly mounted in a fixed frame assembly.

In Fig. 5 ist eine typische mechanische Programmiereinrichtung gezeigt, mit deren. Hilfe eine genaue Zeitsteuerung der richtigen Reihenfolge von Vorgängen bei irgendeiner bestimmten Maschinenform vornehmbar ist. Das Zahnrad 92 kann dabei z.B* an einem Photoleiter-Zuführmechanismus an der Lade- oder Belichtun-jsstation angeordnet sein. Das Zahnrad 92 trabt ein Zahnrad 93 an, das seinerseits ein Zahnrad 95 antreibt, welches auf der Welle der Zuführwalze angeordnet sein kann» Das Zahnrad 95 kämmt mit einem Zahnrad 94·, das an dem Ende der Entwicklerwalzenwelle angeordnet ist, und mit dem Antriebszahnrad 96. Das Zahnrad 96 kämmt mit dem Zahnrad 97, das auf der Welle der Nooke 98 angeordnet ist. Zur genauen Programmsteuerung der verschiedenen Operationen oder Funktionen kann dabei irgendeine geeignete Zahnradfolge verwendet werden. Darüber hinaus kann die mechanische Programmiereinrichtung durch irgendwelche konventionellen Zahnräder, Riemenscheiben oder Riemen oder durch eine Kombination derartiger Elemente gebildet sein, ^ie Untersetzungsverhältnisse der z.B. verwendeten Zahnräder sind so gewählt, dai; die gewünschte Programmierung erreicht ist. Die genauen benutzten Untersetzungsverhältnisse hängen von der genauen {Form der Endmaschinenanordnung ab; sie können ohne weiteres für irgendeine bestimmte Anordnung bestimmt werden.In Fig. 5 a typical mechanical programming device is shown with the. Help a precise timing of the correct sequence of operations can be carried out in any particular form of machine. The gear 92 can e.g. on a photoconductor feed mechanism at the loading or exposure station be arranged. The gear 92 trots a gear 93, which in turn drives a gear 95, which can be arranged on the shaft of the feed roller »The gear 95 meshes with a gear 94 · on the end of the developer roller shaft is arranged, and with the drive gear 96. The gear 96 meshes with the gear 97, which is arranged on the shaft of the nooke 98. For precise program control any suitable gear train may be used for the various operations or functions. In addition, the mechanical programming device by any conventional gears, pulleys or belts, or by a combination of such elements be formed, ^ he reduction ratios of the gears used, for example, are chosen so that; the desired programming is reached. The exact reduction ratios used depend on the exact {shape of the end machine arrangement away; they can readily be used for any particular one Arrangement can be determined.

BAD ORIGINALBATH ORIGINAL

009884/1913-009884 / 1913-

Die Abgabeoberfläche kann irgendeine geeignete Form "und Größe besitzen. Sie kann z.B. die Form einer drehbar gelagerten Walze besitzen, wie dies in verschiedenen Figuren gezeigt ist, oder durch eine bewegliche endlose Bahn oderThe dispensing surface can be of any suitable shape and size. For example, it can be in the form of a rotatable Have roller, as shown in various figures, or by a movable endless track or

gebildet sein
ein entsprechendes Band^ Die Oberfläche kann dabei glatt sein; bevorzugt wird jedoch eine gleichmäßig gemusterte Fläche, die erhöhte Bereiche oder "Erhebungen" und abgesenkte Bereiche oder "Täler" aufweist. Eine typische Abgabeeinrichtung istbe educated
a corresponding band ^ The surface can be smooth; however, a uniformly patterned surface is preferred which has raised areas or "elevations" and lowered areas or "valleys". A typical dispenser is

ein© durcha © through

eine zylindrische Walze mit einer Oberfläche, die durch/drei Schraubenlinien, durch pyramidenförmig verlaufende Linien oder durch quadratförmig verlaufende Linien gebildete Ober- % flächengravur gemustert ist. Kopien von guter Qualität werden bei relativ bequemem.Betrieb mittels einer bevorzugten Abgabewalze erzielt, die ein durch drei Schraubenlinien· gebildetes Muster enthält, und zwar bei einer Liniendichte zwischen 80 und 300 Linien auf 25,²J- cm. Der Linienbereich mit etwa 180 biw 250 Linien auf 25,4- cm wird dabei bevorzugt. Der Schnittwinkel der erwähnten Linien bezogen auf die Längsachse liegt zwischen etwa 30°bis etwa 60°; ein Winkel von etwa 45° wird dabei bevorzugt. Die Linientiefe liegt zwischen etwa 38 Ai und etwa 152/U. Typische Materialien, aus denen die Abgabewalze hergestellt werden kann, umfassen Stahl, riessing, Aluminium, Hylon oder Lucite. Die Walze kann in typischer Weise eine μ Welle aus einem ersten Material enthalten und eine Hülse oder Buchse aus einem zweiten Material. Eine typische Walze kann einen Innendurchmesser von etwa 25,4 mm und eine Länge von etwa 229 mm besitzen. Wird eine bahn- oder bandartige Abgabeeinrichtung verwendet, so ist es wünschenswert - nicht aber stets erforderlich - daß an jeder Station der die Bewegungsbahn festlegenden Oberfläche die betreffende Abgabeeinrichtung auf der Unterseite mittels einer Druckwalze oder durch eine andere Anordnung getragen wird. Durch Bereitstellen eines derartigen Trägers ist sichergestellt, daß Entwicklermateriala cylindrical roller having a surface formed by / three helices by pyramid-shaped lines extending or square-shaped lines extending upper% is patterned surface engraving. Copies of good quality can be obtained at relatively bequemem.Betrieb by means of a preferred delivery roller which contains an image formed by three helical · pattern, specifically at a line density of between 80 and 300 lines at 25, ² J cm. The line area with around 180 to 250 lines on 25.4 cm is preferred. The angle of intersection of the lines mentioned in relation to the longitudinal axis is between approximately 30 ° and approximately 60 °; an angle of about 45 ° is preferred. The line depth is between about 38 Ai and about 152 / U. Typical materials from which the dispensing roller can be made include steel, riessing, aluminum, hylon or lucite. The roller can contain a μ shaft of a first material and typically a sleeve or socket of a second material. A typical roller can have an inside diameter of about 25.4 mm and a length of about 229 mm. If a web-like or belt-like delivery device is used, it is desirable - but not always necessary - that the relevant delivery device is supported on the underside by means of a pressure roller or some other arrangement at each station of the surface defining the movement path. By providing such a carrier it is ensured that developer material

BAD 009884/1913 BATH 009884/1913

mit Hilfe der Zuführfläche oder -oberfläche der Ab^abeoberflache in angemessener Weise zugeführt wird, so daf· eine angemessene Abstreifung und anschließend eine Entwicklung des Bildes erzielt werden.with the help of the supply surface or surface of the Ab ^ abeoberflache is supplied in an appropriate manner so that adequate stripping and then development of the image can be achieved.

Die Entwicklerzuführfläche oder -oberfläche kann irgendeine geeignete Größe und Form besitzen. Sie kann auch die Form einer drehbar angeordneten Walze oder die Form eines endlosen Bandes oder die Form einer Bahn besitzen. Sämtliche für die Zuführoberfläche benutzten Materialien sollten dabei gegenüber Alterung, Abnutzung und chemischen Angriff durch den Entwickler beständig sein. Für die Auswahl des Zuführoberflächenmaterials steht dabei ein erheblicher Bereich zur Verfugung, wenn die betreffende Oberfläche nur als Zuführoberfläche verwendet v/ird. Dies bedeutet, daß bei einziger Verwendung der betreffenden Zuführoberfläche zur Speisung oder Beschickung der Abgabeoberfläche mit nicht abgemessenen Ehtwicklermengen in nicht abgestrichener Form jedes Entwicklerzuführsystem gearbeitet v/erden kann.The developer supply face or surface can be any be of suitable size and shape. It can also be in the form of a rotatably arranged roller or in the form of an endless one Tape or have the shape of a web. All materials used for the feed surface should be opposite Aging, wear and tear and chemical attack by the developer be resistant. For the selection of the feeding surface material There is a considerable area available if the surface in question is only used as a feed surface. This means that with a single use of the feed surface in question for feeding or charging the delivery surface v / ground any developer supply system with unmeasured developer quantities in uncoated form can.

Dient die Zuführoberfläche jedoch sowohl als Zuführoberflache als auch als Abstreifoberfläche, so sollte die Oberfläche vorzugsweise glatt sein, um jegliche Verformung der Abgabeoberfläche zu vermeiden, mit der sie während des AbstreifVorgangs in Bewegungskontakt gelangt. Ferner sollten die für die Kombination von Zuführoberfläche und Abstreifoberfläche verwendeten Materialien relativ-elastisch sein und eine mit Hilfe eines Härtemessers (Α-Skala) gemessene Shorehärte zwischen etwa 4-0 und etwa 90 besitzen. Eine optimale Vervielfältigungqualität kann bei einem Härtegrad zwischen etwa 50 und 60 erzielt v/erden, Für die Zuführoberfläche kann irgendein geeignetes Material gewählt werden. Typische Beispiele von Materialien, die für diese Oberfläche verwendet werden können, umfassen Stahl, Silikongummi, Fluorsilikongummi, Buna N-Gummi, Neopren,However, the feed surface serves both as a feed surface as well as a wiping surface, the surface should preferably be smooth in order to avoid any deformation of the dispensing surface that it faces during the wiping process comes into moving contact. It should also be used for the combination be relatively elastic materials used by the feeding surface and the wiping surface and one with the help of a Shore hardness measured by the hardness meter (Α scale) between about 4-0 and own about 90. An optimal reproduction quality can be achieved with a degree of hardness between approx. 50 and 60, Any suitable material can be selected for the feed surface. Typical examples of materials used for This surface can be used include steel, silicone rubber, fluorosilicone rubber, Buna N rubber, neoprene,

BAD ORIGINALBATH ORIGINAL

009884/1913009884/1913

urethane und Polyurethane* Wird die walzenförmige Abstreichoberfläche verwendet, so umfassen typische elastische Stoffe Fluorsilikon (W2249.), Fluorsilikon Silastic LS63U, Silastic LSr3.11, alles Stoffe, die von der Dow Corning erhältlich sind. Ferner umfassen die betreffenden Stoffe die folgenden Polyurethane: Diso~rin 6245 und Disonrrin 7560, beide Produkte sind von der DisoKrin Industries erhältlich. Das von der Vi..:. :,:'ace Company hergestellte Hirilcopolymer Ilorilith ist ebenfalls verwendbar.urethane and polyurethane * Will be the roller-shaped wiping surface are used, typical elastic fabrics include fluorosilicone (W2249.), fluorosilicone Silastic LS63U, Silastic LSr3.11, all fabrics available from Dow Corning. The substances in question also include the following polyurethanes: Disorin 6245 and Disonrin 7560, both products are available from DisoKrin Industries. That of the Vi ..:. :,: 'ace Company manufactured Hirilcopolymer Ilorilith can also be used.

Wenn die .„uführ- und Abstreiffläche die Form einer zylindri- J scheu Walze besitzt, 'sollte die Walze genau- in ihrer Mitte zentriert sein, um einen £leichmäßigen Einrriff, d.h. eine gleichmäßige Berührung mit der Entwicklerabgebefläche zu bewirken, iiine typische Walze umfaßt eine etwa 19 mm dicke Stahlv/nlze mit einem elastischen überzug oder einer elastischen Hülse, deren Dicke etwa 3,2 mm betragt. Damit steht eine Walze zur Verfü(:un_v , deren Außendurchmesser etwa 25,4 mm beträgt.If the feeding and wiping surface is in the form of a cylindrical roller, the roller should be exactly centered in its center in order to achieve smooth engagement, ie, even contact, with the developer dispensing surface, including a typical roller an approximately 19 mm thick steel mesh with an elastic coating or an elastic sleeve, the thickness of which is approximately 3.2 mm. This means that a roller is available (: un _v , the outer diameter of which is about 25.4 mm.

Werden gesonderte Walzen für die Entwicklerzuführoperation uiia für die Abstreifoperation verwendet, so kanr. die Zufvhr-• el:(die oben beschriebenen Eigenschaften besitzen, und die Abstreifwalze kann die Eigenschaften besitzen, die im Einblick auf die Kombination von Zufuhr- und Abstreifwalze erläutert % worden sind, oder sie kann die Form einer schsibenv/ischerartigen. Walze besitzen.If separate rollers are used for the developer supply operation uiia for the stripping operation, so can. the Zufvhr- • el: (the above-described properties have, and the stripping roller may have the properties described in the insight to the combination of feed and stripping roller% have been, or may have the form of a schsibenv / ischerartigen roller..

Das Abstreifen des auf die Abgabefläche aufgebrachten Entwicklers kann ferner mittels Abstreifblätter erfolgen« Sin sich dabei über die gesamte Länge der Abgabefläche erstreckendes Hauptabstreifblatt kann allein oder in Verbindung mit Ecken- und Kantenabstreifblättern verwendet werden. Die Abstreifblätter können aus irgendeinem geeigneten Material bestehen, aas -egenüber der Alterung, Abnutzung und demThe stripping of the developer applied to the dispensing surface can also be done by means of scraper blades. A main scraper blade extending over the entire length of the dispensing surface can be used alone or in conjunction with Corner and edge blades can be used. The scraper blades can be made of any suitable material, aas -compared to aging, wear and tear and the

009884/1313 BADOR₁G₁NAL009884/1313 BADOR ₁ G ₁ NAL

chemischen Angriff durch die Entwlcklerflüssigkeit beständig ist. Typische Materialien umfassen Stahl, Silikongummi, Fluorsilikongummi, Urethane, Polyurethane, Mylar (Polyester). Die Blätter sollten fest genug sein, um jeglichem Druck widerstehen zu können, der sich dadurch ausbildet, daß der Entwickler durch das jeweilige Abstreifblatt zurückgehalten wird. Das Hauptabstreifblatt sollte die Abgabefläche längs einer Linie oder eines schmalen Weges berühren, um die gewünschte Abmessung des Entwicklermaterials auf der Abgabefläche in abgestrichener Form zu bewirken. Das Kanten- und Eckenabstreifblatt sollte die Kante der Abgabefläche und die Ecke berühren, um überschüssigen Entwickler abzuführen und die Ansammlung von Entwickler in der Ecke der Abgabefläche zu verhindern. In diesem Zusammenhang sei erwähnt, daß entsprechende Maßnahmen an anderer Stelle näher ausgeführt werden.chemical attack by the developer liquid resistant is. Typical materials include steel, silicone rubber, fluorosilicone rubber, urethanes, polyurethanes, mylar (polyester). The leaves should be strong enough to withstand any pressure caused by the Developer is retained by the respective blade. The main blade should be along the dispensing surface touch a line or a narrow path to get the one you want To effect dimensioning of the developer material on the dispensing surface in a smeared form. The edge and Corner wiper blade should touch the edge of the dispensing surface and the corner to remove excess developer and the build-up of developer in the corner of the delivery area too impede. In this context it should be mentioned that corresponding Measures are detailed elsewhere.

Ferner sei erwähnt, daß an anderer Stelle Systeme näher beschrieben werden, in denen ein angemessenes Abstreichen des Entwicklers dadurch erfolgt, daß eine Oberfläche, bei der es sich um eine Zusammenfassung.; von Zuführoberfläche und Abstreifoberfläche oder um eine Abstreif oberfläche handeln kann, p;ef-< über einer Ab:~abeflache bewegt wird, und zwar derart, daß zwischen den sich berührenden Oberflächen eine Differenz-Umfangsgeschwindigkeit vorhanden ist. Die Oberflächen stehen bei Bewegung unter Drucl: miteinander in Berührung, und zwar derart, daß die Abstreiffläche eine reine Abstreifwirkung an der Abgabefläche ausführt.It should also be mentioned that systems are described in more detail elsewhere in which an adequate wiping of the Developer is done by having a surface that is a summary .; of feeding surface and wiping surface or can be a wiping surface, p; ef- < is moved over an ab: ~ abeflache in such a way that a differential circumferential speed between the contacting surfaces is available. When moving, the surfaces are under pressure: in contact with one another, namely such that the wiping surface has a pure wiping effect the delivery area.

Jedes geeignete Entwicklermaterial kpnn verwendet werden. Polare und nicht oolare Flüssigkeiten und trockenes pulverförmiges Materiel, wie herkömmlicher Toner, und. jegliches Dartikelförmiges I'aterial, das gelederj werden kann, sind brauchbare 3ntwicklerstoffe. Es ist zweckmäßig, daß die Entwickler mit ien osrtilielförmi^en Stoffen kompatibel sind,Any suitable developer material can be used. Polar and non-oolar liquids and dry powdery Material like conventional toner, and. any dart-shaped material that can be leather useful developing agents. It is convenient that the developer are compatible with all organic fabrics,

BAD ORIGINAL 009884/19 1-3-BATH ORIGINAL 009884/19 1-3-

20311:20311:

mit denen sie wahrend 4es Betri;e\bs des Entwieklörmodüls iö Kontakt gelangen. Flüssige Entwickler können dxepergierte Pigmente und/oder gelöste Farbstoffe enthalten,* Typische > flüssige Entwickler können aus kommerziell erhältlichen Farben ausgewählt werden, die auf Wasser_T, Öl- und Alköholbasis aufgebaut sind, und die u.a. Mineralöl, ölsäure, PoIypropylenglycol, Iiösungsmittel(Scharerbenzin^Glyzerol und Sorbital umfassen.with whom you come into contact during the operation of the Entwieklörmodüls. Liquid developers may contain dxepergierte pigments / or dissolved dyes and, * Typical> liquid developer can be selected from commercially available paints, which are based on water _T, oil and Alköholbasis, and among other things, mineral oil, oleic acid, PoIypropylenglycol, Iiösungsmittel (Scharerbenzin ^ Include glycerol and sorbital.

Typische trockene Pulvermaterialien umfassen Holzkohle, Ruß und herkömmlichen Toner. Jeder geeignete Farbstoff kann m ausgewählt werden. Typische Farbstoffe umfassen Ruß und andere Partikelformen von Kohlenstoff, Eisenoxyd, Zinkoxyd, Titandioxyd, Ultramarinblau, Methylenblau, Methylviolettanat. Sofern erforderlich, können Dispersionsmittel, Feuchtigkeits-Regelungsstoffe und Fixierstoffe hinzugegeben werden.Typical dry powder materials include charcoal, carbon black, and conventional toners. Any suitable dye may be selected m. Typical dyes include carbon black and other particulate forms of carbon, iron oxide, zinc oxide, titanium dioxide, ultramarine blue, methylene blue, methyl violet anate. If necessary, dispersants, moisture control agents, and fixatives can be added.

Jede geeignete elektrostatographische Bildfläche kann benutzt werden. Geeignete dielektrische Stoffe und Photoleiter können in Form von Trommeln, Platten oder Bahnen verwendet werden.Any suitable electrostatographic imaging surface can be used will. Suitable dielectric materials and photoconductors can in the form of drums, plates or webs.

Typische Stoffe umfassen Selen oder Selenlegierungen, Zinkoxydbindemittelschichten, PhthalozyaninbindemittelschichtenTypical substances include selenium or selenium alloys, zinc oxide binder layers, Phthalocyanine binder layers

oder Polyvinylcarbozol. m or polyvinylcarbozene. m

Um ein Verspritzen und eine Verunreinigung der sich mechanisch bewegenden Teile durch den Entwicklerstoff auf einen minimalen Wert herabzusetzen, sollte das Entwicklermodul im wesentlichen vollständig gegen äußere Einflüsse abgeschlossen sein. Eine Ausnahme hiervon bildet Jedoch die Zuführung des Entwicklermaterials in das in dem Modul befindliche Entwicklerbad und die für die Öffnilng/für die Abgabefläche notwendig ist, um mit dem Photoleiter in die Entwicklungsstellung zu gelangen« Das Gehäuse oder der Trog des Entwicklermoduls, wie es in Fig*1 angedeutet ist, kann aus einem Stück bestehen und z*B. durchTo a splash and a contamination of the mechanically moving parts by the developer to a minimum Reduce value, the developer module should be essentially completely sealed against external influences. An exception to this, however, is the supply of the developer material in the developer bath in the module and which is necessary for the opening / for the dispensing area, to get into the development position with the photoconductor « The housing or trough of the developer module as shown in Fig * 1 is indicated, can consist of one piece and z * B. by

008114/1913008114/1913

20312031

einen stranggeprößten Alüminiumtrog gebildet sein* Uta eine Betriebslebensdauer zu gewährleisten, werden die in defii Ent-* Wicklermodul verwendeten Materialien vorzugsweise nicht dein Angriff durch den speziell verwendeten Entwickler ausgesetzt.an extruded aluminum trough be formed * Uta one In order to guarantee the service life, the * The materials used in the winder module are preferably not yours Exposed to attack by the specially used developer.

Das gesamte-Entwicklermodul ist an einer Welle schwenkbar gelagert, die längs des Moduls verläuft. In typischer Meise kann die Zuführ- oder Druckfarbenwalze als Schwenkungswelle dienen, so daß in dem Pail, daß die Nocke an der Nockenaufnanmefläche der Stirnplatten oder Endplatten zur Anlage kommt, die Abgabefläche aus der Entwicklungsstellung von dem Photoleiter zurückgezogen wird. Es kann auch irgendeine andere geeignete Schwenkungseinrichtung verwendet werden. Das Ent-,wicklermodul ist durch Federkraft in Richtung, auf die Photoleiteroberfläche belastet, wodurch die erforderliche Anschmiegung für die Entwicklung erzielt wird. In typischer Weise sind die Abgabefläche und der Photoleiter längs einer Linie oder längs eines sehr kleinen Bereichs in Kontakt, und zwar unter Druck« Der längs dieser Berührungslinlie ausgeübte Druck kann sich mit der Gesamtentwioklungsgeschwindigkeit und mit der Härte der sich berührenden Flächen und der Photoleiter-Andruckwalze ändern. Im allgemeinen gilt, daß bei höheren Geschwindigkeiten und härteren Materialien höhere Drucke angewandt werden können. Im allgemeinen liegt bei Entwicklungsgeschwindigkeiten bis zu etwa 5OQ mm pro Sekunde (entsprechend 20 Zoll pro Sekunde) und Verwendung von Stahlabgabeflächen der zwischen dar Entwicklerwalze und dem Photoleiter ausgeübte Druck zwischen etwa einem und etwa drei Pfund auf 25,4· mm.The entire developer module can be pivoted on a shaft stored, which runs along the module. Typically, the feed or ink roller can act as a pivot shaft serve so that in the pail that the cam on the Nockenaufnanmefläche of the end plates or end plates comes to rest, the release surface from the development position of the Photoconductor is withdrawn. Any other suitable pivoting device can also be used. The developer module is loaded by spring force in the direction of the photoconductor surface, creating the necessary snugness for development is achieved. Typically, the delivery surface and photoconductor are along one Line or along a very small area in contact, under pressure «That applied along this line of contact Pressure can vary with the overall rate of development and with the hardness of the contacting surfaces and the photoconductor pressure roller change. In general, higher pressures will be applied at higher speeds and harder materials can be. In general, development speeds of up to about 50 Ω mm per second (corresponding to 20 inches per second) and use of steel release surfaces between the developer roller and the photoconductor applied pressure between about one and about three pounds per 25.4mm.

Das Entwicklermodul kann in Entwicklungssystemen Verwendet werden, mit deren Hilfe Tbei «ferEnt wicklung eine Geschwindigkeit bis zu etwa 508 mm pro Sekunde erzielt wird. Obwohl eine Entwicklung bei einer Geschwindigkeit ötziölt werden kann _t dieThe developer module can be used in development systems with the aid of which a speed of up to approx. 508 mm per second can be achieved during development. Although a development can be exhausted at a rate _t that

G 0 9 8 8 4 / 1 9 1 3G 0 9 8 8 4/1 9 1 3

geringer ist als etwa 50,8 mm pro Sekunde, ist diese Geschwindigkeit für kommerzielle Vervielfältigungszwecke relativ unpraktisch. Vervielfältigungen von guter Qualität werden bei bevorzugten Entwicklunggeschwindigkeiten von ct:w3 12,7 cm/sec bis etwa 38,1 cm/sec erzielt. Eine optimale Vervielfältigunesqualität wird bei Geschwindigkeiten zwischen etwa 20 cm/see und etwa 33 cm/sec erzielt.is less than about 50.8 mm per second, this speed is for commercial copying purposes relatively impractical. Good quality reproductions are made at preferred development speeds of ct: w3 12.7 cm / sec to about 38.1 cm / sec achieved. An optimal one Duplication quality is achieved at speeds between about 20 cm / sec and about 33 cm / sec achieved.

Das 3ntwicklennodul kann insbesondere bei Anwendung der Gleit- oder Zuführwalzen-Abstreifverfahren wirksam bei Entwicklunrs-eschwindifTkeiten bis zu etwa 636 cm/sec (entsprechend ?.50 ..oll Dro Sekunde)* eingesetzt werden. <The 3ntwicklennodul may in particular when using the sliding or feeding roller stripping effective up to about 636 cm / sec (corresponding to?. 50 ..oll Dro second) at Entwicklunrs-eschwindifTkeiten be used *. <

Die iintwicklun.; kann durch Anwendung herkömmlicher Flussigkeitse .,twickluiii-.sν erfahren erzielt werden, bei den*³¹ eine elektroohoretische Bewegung geladener Teilchen, die in der EntwieklerfliT-ssigkeit suspendiert sind, unter dem Einfluß eines angelegten elektrischen Feldes auftritt. Eine bevorzugte Entwicklun wird mit Hilfe der eine polare Flüssigkeit verwendenden }2ntwic.:lun stechnil: erzielt, wie sie in der US-Patentschrift 3 064- 043 an^eeeben ist. Bei dieser Entwicklunrstechnik .wird angenommen, daß die gesamte Entwicklerflüssigkeit, einschließlich jeplichen dispensierten oder suspendierten Piments, die Seiten der eingedrückten Bereiche oder '-'Täler¹¹ der Ab~abeflache oder -oberfläche hochwandert und auf die Bildoberfl'äche nrelangt, und zwar nur an den Stellen, an denen eine elektrische Ladun.r auf der betreffenden Bildfläche vorhanden, i^t. Bei dieser Technil: bzw. bei diesem Ye^fahren werden nahezu nur die Bildbereiche von der Er.twicklerflüssir,-keit berührt. Sine Entwicklunr; mit trockenem pulverförmiger. . EntwiCi-lerstof f wird durch die herirömmlicher, elei.troDhotocraphisciiGii Entwiclilun^smechanismen erzielt, bei denen das Pulver von der Abgabefläche angesogen wird., und svrar vcn Jener. Ber.ei3hen-.r.?r Eilefläche, in denen eine elektrische Ladurr,The iintwicklun .; can be prepared by using conventional Flussigkeitse., twickluiii-.sν be achieved learn a elektroohoretische motion of charged particles that are suspended LIQUID EntwieklerfliT-in occurs at the * ³¹ under the influence of an applied electric field. A preferred DEVELOPMEN is stechnil with the aid of a polar liquid used} 2ntwic.:lun: obtained as eeeben in US Patent 3 043 064- to ^. In this development technique it is assumed that all of the developer liquid, including any dispensed or suspended pimento, migrates up the sides of the indented areas or valleys ^{11 of} the surface or surface and only reaches the image surface the places where an electrical charge is present on the picture surface in question, i ^ t. With this technique, or with this movement, almost only the areas of the image are touched by the developer fluidity. Its development; with dry powdery. . Developing agent is obtained by the more traditional, elei.troDhotocraphisciiGii development mechanisms, in which the powder is sucked from the delivery surface, and by that. Ber.ei3hen-.r.?r express area in which an electric loader,

009884/1913009884/1913

zurückgeblieben ist. Wird ein trockner Entwickler verwendet,-so kann eine andere Zuführeinrichtung für das Entwicklermodul zweckmäßig sein. In typischer Weise kann die Bohrleitung das Entwicklermodul mit einer esdbemen Speisequelle verbinden, die in einer hohen Ebene angeordnet ist, um von dieser Stelle aus Entwickler in das in dem Entwicklermodul befindliche Entwicklerbad abgeben au können»lagged behind. If a dry developer is used, -so Another supply device for the developer module may be expedient. Typically the drilling line can connect the developer module to an esdbemen supply source, which is arranged at a high level, in order to transfer developer from this point into the developer module located in the developer module To be able to deliver developer bath »

Sofern erwünscht, kann eine Umkehrentwicklung erfolgen, indem an die Abgabeeinrichtung ein Potential von der gleichen Polarität und etwa der gleichen Größe angelegt wird, wie es die geladenen Bereiche des Bildes besitzen«, Sodann existiert zwischen den nicht geladenen Bereichen der ein Bild tragenden Oberfläche und dem auf.der Äbgabeoberflache vorhandenen Entwickler ein elektrisches Feld, während zwischen den geladenen Bereichen der das Bild tragenden Fläche oder Oberfläche und dem Entwickler kein elektrisches Feld vorhanden ist. Damit wird in der Entwicklun;rsstellung der Entwicklerstoff von dem nicht geladenen Bild angezogen.If desired, an inverse development can be done by to the delivery device a potential of the same Polarity and about the same size as the charged areas of the picture have ', then exists between the uncharged areas of the surface carrying an image and the developer present on the surface an electric field while between the charged areas of the image-bearing surface or surface and there is no electric field available to the developer. In the development position, the developer is thus removed from the not loaded image tightened.

An Hand nachstehend aufgeführter Beispiele wird das erfindungsgemäße Verfahren weiter¹ beschrieben und erläutert. Zs sei ^ecoch bemerkt, da£ die Erfindung auf diese BeispieleWith reference to examples specified below method further ¹ according to the invention will be described and explained. It should also be noted that the invention is based on these examples

nicht l-eschtMnkt ist. Samt] iche angegebenen Anteile undis not deleted. All of the specified proportions and

i rozentsätze beziehen sich, jeweils suf Ce wicht α an "ab en, nc fern nichts anderes" an::e-_:eben ist. i percentages relate, in each case suf Ce weight α to "ab en, nc far nothing else" to :: e- _: even is.

Example I.

.Ein- dem in Fi~. 1 beschriebenen Sntwic>:lermodul entsprechendes Entwicklencdul wird aus einer einstückigen Sntwicklerschale hergestellt, die eine Län„e von etwa 23 era besitzt. Die Ab de ei:- und Stirnolatten sind an der Entwicklerschale befestigt, und in ;,en Stimclatten ist al::; Zuführwalze eine.One in Fi ~. 1 described Sntwic>: lermodule corresponding Developing module is made from a one-piece developer tray produced, which has a length of about 23 inches. The Ab de ei: - and front slats are attached to the developer tray, and in;, en Stimclatten is al ::; Feed roller one

BAD ORiGINAL 0 0 9 8 8 U I 1 9 1 3 BAD ORiGINAL 0 0 9 8 8 UI 1 9 1 3

oberflächenbearbeitete Walze aus rostfreiem Stahl gelagert, deren Durchmesser etwa 19 mm beträgt. Die Abgabewalze aussurface-machined roller made of stainless steel, whose diameter is about 19 mm. The delivery roller off

chromüberzogeneni Stahl und einem Durchmesser von etwa 25,4 mm ist ebenfalls in den Stirnplatten gelagert. Die Abgabewalze trägt ein durch drei Schraubenlinien gebildetes Muster mit etwa 180 Linien auf 25,4· mm, die unter einem Winkel von 45° zur Achse in die Oberfläche eingeschnitten sind, und zwar in einer Tiefe von etwa 51/U. Die Zuführwalze und die Abgabewalze sind derart voneinander beabstandet, daß ihre rotierenden Oberflächen in einer Entfernung von etwa 127/U voneinander entfernt sind. Ecken- und Kanten-Abstreifblätter d mit einer Dicke von etwa 0,76 mm sind unter einem Winkel von etwa 90° zur Tangente des Berührungspunktes mit der Entwicklerwalze fest angeordnet. Ein Hauptabstreifblatt aus·rostfreiem Stahl mit einer Dicke von etwa 0,2 mm ist auf der Entwicklerwalze angeordnet, und zwar derart, daß es unter einem Winkel von etwa 60 bezogen auf die Tangente der Berührungslinie verläuft. Der Entwicklervorratsteil der Entwicklerschale Wird mit Entwickler folgender Zusammensetzung gefüllt:chrome-plated steel and a diameter of about 25.4 mm is also stored in the end plates. The dispensing roller bears a pattern formed by three helical lines with approximately 180 lines by 25.4 mm, which are cut into the surface at an angle of 45 ° to the axis, to a depth of approximately 51 / rev. The feed roller and the discharge roller are spaced from one another such that their rotating surfaces are spaced apart by a distance of about 127 / rev. Corner and edge scraper blades d with a thickness of about 0.76 mm are fixedly arranged at an angle of about 90 ° to the tangent of the point of contact with the developer roller. A main stainless steel blade about 0.2 mm thick is positioned on the developer roller so that it is at an angle of about 60 degrees with respect to the tangent of the line of contact. The developer supply part of the developer tray is filled with developer of the following composition:

Leichtes Mineralöl 45 GewichtsteileLight mineral oil 45 parts by weight

Microlith.CT .. 27 "Microlith.CT .. 27 "

Ganex V 216 23"Ganex V 216 23 "

VM55O Methyltannat 4 "VM55O methyl tannate 4 "

Paraflint RG-Wachs 1 "Paraflint RG wax 1 "

Microlith CT ist ein harziges dispergiertes Rußpigment, das aus etwa 40# Ruß und 60$ Esterharzgummi besteht und das von der Firma GIBA hergestellt wird. Ganex V216 ist ein von der GAJ¹ Corporation hergestelltes, mit einem Alkyd versehenes Polyvinylpyrrolidon-Dispersionsmittel. VM55O ist ein von der Magruder Color Company hergestelltes, in Mineralöl gespültes Pigment. Paraflint ist ein von der Moore und Munger Company hergestelltes hartes synthetisches Wachs .Microlith CT is a resinous dispersed carbon black pigment, which consists of about 40 # carbon black and 60 $ ester resin rubber and which is manufactured by the GIBA company. Ganex V216 is an alkyded polyvinylpyrrolidone dispersant manufactured ^{by GAJ 1 Corporation.} VM55O is a mineral oil rinsed pigment made by Magruder Color Company. Paraflint is a hard synthetic wax manufactured by the Moore and Munger Company.

BAD ORiGINAL 0 0 9 8 84/1913BAD ORiGINAL 0 0 9 8 84/1913

2031520315

Über eine Druckwalze wird ein ein zu entwickelndes Bild tragendes Zinkoxyapapier Mnweggeführt. Wenn die Vorderkante sich dem Anfarags^EntwicklunGsbereicb nähert, wird die Ehtwlcklerabgabefläch® mit der Vorderkante der Bildfläche in die Entwicklung Stellung gebracht, indem die Iiocice von der Hockenaufnahme- oder Nockenanlagefläche- weggeführt wird. Die Entwicklung wird mit @1βθρ Geschwindigkeit von etwa"30,5. durchgeführt, wobei öle Umfangsgeschwindigkeit etwa 1,85 mal der Umfangsgeschwindigkeit; der. Zuführwalze entspricht. Der in bildmaßiger Verteilung auf dor das Bild tragenden Oberfläche befindliche Entwickler wird auf Xerox-^C^^f-Kopierpapier übertragen. Dabei sind eine licht© von 0,8 und ein Hintergrund" von 0^05 in Vervieliältigiraggiquslität festzustellen. -.A zincoxy paper Mn, bearing an image to be developed, is passed over a pressure roller. When the leading edge is approaching the starting point of development the Ehtwlcklerabgabeefläch® with the front edge of the picture surface brought into the development position by the Iiocice of the squat receiving or cam abutment surface is carried away. The development is @ 1βθρ speed of about "30.5. carried out, with oils peripheral speed about 1.85 times the peripheral speed; the. Feed roller corresponds. The in image-wise distribution on the surface carrying the image any developer is transferred to Xerox ^ C ^^ f copy paper. There is a light © of 0.8 and a background " of 0 ^ 05 in multiplicity to be determined. -.

Das Verfahren gemäß B@ispi®l I wirä mit -Ist Ausnahme wiederholt,, daß ein Urethan-Hanpibabstireifblatt; in einer Dicke von etwa 1,9 mm (entsprechend O_sO75 Zoll) «rad einer Shore-A-Härte von etwa 75 bis 85 unter einem IrJink©! -toh etwa 45 bezogen auf die Tangente an der Berührungslini® ¥©rtjendet wird. Darüber hinaus wird das Zinkoxjdpapier durck ©inen Phthalocyaninbindemittelschicht-Photoleiter ersotgfea Ber benutzte Entv/ickler enthält die folgende Zusaiiiens©tgsng:The procedure according to B @ ispi®l I is repeated with the exception that a urethane Hanpibabstireifblatt; in a thickness of about 1.9 mm (corresponding to O _s O75 inch) "rad a Shore A hardness of about 75 to 85 under a IrJink ©! -toh about 45 based on the tangent at the contact line ¥ © rtjendet. In addition, the zinc oxide paper is printed on the phthalocyanine binder layer photoconductor as a result of the developer and contains the following information:

Drakeol 38 GewichtsanteilDrakeol 38 part by weight

Microlith CT 38 "Microlith CT 38 "

Rucoflex.TG-8 · 9 ' "Rucoflex.TG-8 9 '"

Ganex V216 '14- "Ganex V216 '14 - "

Drakeol 9 ist ein von der Pennsylvania Hefining Company hergestelltes Mineralöl. Rucoflex TG-8 ist ein von der Hooker Chemical Company hergestelltes Triäthjlenglykol-Dicaprylat. Die Bildentwicklung und Übertragung werden in entsprechender Weise ausgeführt,- wie dies im Zusammenhang mit Beispiel IDrakeol 9 is one manufactured by the Pennsylvania Hefining Company Mineral oil. Rucoflex TG-8 is one of the Hooker's Chemical Company manufactured triethylene glycol dicaprylate. The image development and transfer are carried out in a corresponding manner - as described in connection with Example I.

009884/191009884/191

-■27 -- ■ 27 -

aus'eführt worden ist* Die erzielte Vervielfältigung zeigt dabei eine fliehte von etwa 0,7 und einen Hintergrund von etwa 0,01, und zwar unter Ausführung der gleichen Messungen wie beim Beispiel I.* The reproduction achieved shows thereby a flee of about 0.7 and a background of about 0.01 using the same measurements as in Example I.

Im allgemeinen stellen die hier beschriebenen SystemeIn general, the systems described here

ompalrbe, relativ sauber arbeitende Entwicklungssysteme dar, die sich durch einen stark vereinfachten Betrieb auszeichnen und entwickelte Bilder liefern, bei denen eine verminderte ■Hintergrundentwicklung auftritt. Dabei tritt allenfalls nur ein geringer kumulativer Fehler bei der Abgabe von Entwickler an den Bildbereich der ein Bild tragenden Oberfläche auf. Die Vorteile des Systems und der Verfahren gemäß der Erfindung ..Önnen nraphisch durch den Umstand veranschaulicht werden, daßompalrbe, relatively cleanly working development systems, which are characterized by a greatly simplified operation and deliver developed images in which a diminished ■ Background development occurs. At best, only occurs a minor cumulative error in submitting developer to the image area of the image bearing surface. The advantages of the system and the method according to the invention ..Can be illustrated graphically by the fact that

ie verschiedenen Seichnungsfiguren Entwicklersttodule zeigen, die weit ehend zur Veranschaulichung dargestellt sind.he various drawing figures show developer modules that are largely shown for illustrative purposes.

Obwohl im Vorstehenden und bei den die erfindungSGemäfien Ent— . wic.lun GPvcteme benutzenden Ausführungsbeispielen spezielle otoife unn Verfahren beschrieben worden sind, sei bemerkt, dai: cz.Q'j nur sur Srläuteruni; der Erfindung diente. Abschließend sei noch beaierht, άεΓ: auch andere Stoffe Und Verfahren und Kodifikationen .ier jii'findun; eis im Rahmen der Erfindung liegend ■ Ρ-zusehen sind. 'Although in the foregoing and in the cases of the invention Since specific otoife and procedures have been described using exemplary embodiments using GPvcteme, it should be noted that: cz.Q'j only for explanations; served the invention. In conclusion, άεΓ: also other substances and procedures and codifications .ier jii'findun; ice lying within the scope of the invention ■ Ρ-can be seen. '

BAD ORiGfNAL 00 9884/19 13BAD ORiGfNAL 00 9884/19 13

Claims

- PR -

Pate ntansprüc ha

A method for developing an electrostatic latent image present on an area of an image area, characterized in that the area of the image area bearing the image is brought into a development position with a developer dispensing area which has measured amounts of a developer in scraped form , and that the movements of the image surface and the developer release surface are continued until the entire image is developed, whereupon the developer release surface is withdrawn from the development position «

2 · The method according to claim 1, characterized in that an insertable or »from the development position this retractable modular developer system (10; 4-9} 69) with a developer release surface and with a Developer supply source is used and that with actuation of the modular developer system (10 | 49 | 69) the developer release surface is provided with the leveled developer quantities for the development and at the same time the leading edge of the image area of the image area is brought into the development position along a development line.

3. The method according to claim 2, characterized in that the modular developer system (10; 49; 69) in its respective Position is pivoted.

4. The method according to claim 2 or 3, characterized in that the release surface in the developer module (10; 49; 69) wiped with developer by first applying developer from a feeding surface (28) is charged and then wiped off by means of a wiping surface (20).

009884/1913

5. The method according to claim 2 or 3, characterized in that a rotatably mounted cylindrical Roller (16) is used as a developer release surface. ,

6. The method according to claim 5, characterized in that as a cylindrical. Roller (16) a roller having regularly patterned surface of upstanding areas and depressed areas is used and that the developer discharge surface is so charged with developer, the developer amounts are present in the depressed areas of the patterned surface while the * raised portions nearly remain developer free. \

7. The method according to claim 5 or 6, characterized in that as the developer delivery surface of the rotatably mounted cylindrical roller (16) has a surface patterned by three helical lines with a line density between about 80 and about 300 lines on 25, ² J-well, a line angle between about 30 ° and 60 ° based on the longitudinal axis and a line depth between about 37 / * and about 152 / U is used.

S. The method according to any one of claims 5 to 7, characterized in that that the developer release surface with a liquid j | gene developer is charged, in such a way that the Developer deposits in the indented areas, while the raised areas remain almost developer-free, and that the developer discharge surface in the development position has peripheral speeds of up to about 634 cm / s ec is rotated.

9. The method according to any one of Ansnrüche 5 to 8, characterized in that of the rotating developer delivery surface in a first stripping position with the help of

009884/1913 BADORieiNAL009884/1913 BADORIEiNAL

Edge and corner scraper blades (18) and in one second wiping position with the help of a main wiper blade (20) Developer is stripped off and that the developer dispensing surface upon further rotation into the Development division. Arrived in which they are under pressure is brought up to the image area (31).

10. The method according to any one of claims 2 to 8, characterized marked that the araf the developer tax area applied developer is stripped off by means of a moving stripping surface (46) dadmrGfe that the contacting the developer dispenser (16) under pressure Stripping surface rotated at a different peripheral speed is called the developer release area.

11. The method according to one of the claims 5 Ms 8, characterized in that a liquid ItattfielcAer is applied to a rotatably mounted cylindrical Sitwiefelsrsiiführwalzen (60) that the Entwieklerzuffö & rwalze (60) rests under pressure on the surface of the developer delivery roller (61) and that these two jibe (60,61) are rotated at such a different peripheral speeds, that the Entwicklerzuführwal se (60) acts as Entwicklerabstreifwalze that Entwieklermengen are present in the indented portions of the developing roller surface (61) and that the raised areas are almost developer free.

12. The method according to any one of claims 2 to 11, characterized in that that in the developer module (10; 49; 69) the relative positions of the developer delivery surface, the developer feed device and the developer wiping surfaces are always maintained.

13. The method according to any one of claims 2 to 12, characterized

ORIGINAL*

009884/1913

characterized in that a polar developer Liquid or a non-polar liquid is used.

Method according to claim 13 »characterized in that that a developer containing suspended pigment particles is used as the liquid developer.

15. The method according to claim 13, characterized in that a developer containing a dissolved dye is used as the liquid developer.

16. The method according to any one of claims 2 to 15, characterized Recognizes that the developer delivery surface and the Image area in the development position along a line under pressure up to about 3 pounds per 25.4 mm to be brought to bear on each other.

17. The method according to any one of claims 2 to 16, characterized reindicates that the locomotion of the leading edge of the image area on the image surface in the developing position under a pressure of between one and three pounds to 25.4 mm along a line with the developer release

surface is made and that the developer delivery surface Λ and the image area are moved at a speed between about 12.7 cm / sec and 38.1 cm / sec until the development of the entire image is complete.

18. The method according to any one of claims 2 to 17, characterized in that a synchronization of the movement the picture plane in the development position with the retractable one Developer module (1O; 4-9; 69) is made, and in such a way that: the developer mouth into the development position; is brought almost only in the image area of the image surface.

BATH ORIGINAL G09 88 Ul 1 9 1 3 -

19 · Device »for carrying out the procedure according to a ·. * '. of claims 1 to 18, characterized in that a * $ developer module (1Ο§4 · 9 | 69) provided lst _s - contains the a a Entwicklerabgabefläehe defining [email protected] path along which means (17; 4-5 $ 60. ) are provided that deliver the developer to the developer delivery area in unmeasured quantities that © is provided in © stripping device (e.g. 18, 20) that creates a developer delivery area that has measured amounts of developer in a scraped-off form, that facilities are provided which successively lead the developer release surface past the developer release device and the tear-off device and through an opening in the developer module into a development position so that the movable Eitwick release surface with the front edge of an image area to be developed on an image surface (see B. 31 ) can be brought into engagement that devices are provided which the developer delivery surface in the development division via a be correct length of the image carrying the image surface (31) move, and that devices are provided which allow the developer module (10149} 69) to be guided out of the development position.

20. The apparatus according to claim 19, characterized in that the developer release surface defining the path through the Surface of a rotatably mounted cylindrical roller (16; 44; 61) is formed and that means are provided are that the developer discharge area and the image area in the development position almost only in the image area allow the screen to move.

21. Apparatus according to claim 19 or 20, characterized in that the Abstreifeinrichtunrc (18,20) edge and corner blades (18) and a main blade (20) contains.

0 0 9 8 8 4/1313 BAD ORIGINAL

22. Device according to claim 19 or 20, characterized in that that the stripping device contains a rotatably mounted cylindrical roller (46) which under Pressure touches the developer dispensing surface (44) along a line and that the wiper means means contains, the between the developer delivery surface (44-) and the stripping roller (46) a different peripheral speed evokes.

23. The device according to claim 22, characterized in that

that the rotatably mounted cylindrical stripping roller (60) j represents the developer supply device.

24 ·. Device according to claim 19 or 20, characterized in that that the developer module (10j49j69) in one Support part around the rotatably mounted cylindrical developer feed roller (17 »45j6O) is pivotably arranged that the developer delivery surface is a rotatably mounted cylindrical Roller (16; 44j61) with a uniformly patterned ■ The surface is made up of raised areas and indented areas and that the developer discharge roller, the developer feed roller and the stripping surface are fixed and remain in their relative positions. ^

25. The device according to claim 24, characterized in that the developer discharge roller (16j44; 6i) has a surface which has a three helical pattern with a line density between 80 and 300 lines, 25.4 mm and an angle of between about 30 ° and 60 ° in relation to the longitudinal axis and a depth of cut between about 37 A ^and about 152 yes .

BATH 0098 84/1913 -

26. Device according to one of claims 19 to 25, characterized in that for bringing together and Separation of the image area and the developer delivery area a nooke (35 and 98) is provided.

27. The device according to claim 26, characterized in that that a mechanical programming device (92 to 97) is provided which actuates the nooke (98) in such a way that that these are the image area and the developer discharge area over a certain length of the picture surface in the development process brings «,

28. Device according to one of the claims 24 to 27. through this characterized in that the developer feed roller (17 »45j6O) in the developer supply position with a developer reservoir composite © »and that the © developer feed roller (17 »* 5s6O) and the Sntwiekler delivery roller (16 ;. 44j61) can be rotated in this way in a common questioning device are mounted that their longitudinal axes are parallel to each other get lost",

BATH ORIGINAL

009884/1913

' * "■.:■■ ' * "■.: ■■

Learieit·Learieit